SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004805 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004805
Domain Number 1 Region: 42-68
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000412
Family Ran binding protein zinc finger-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004805   Gene: ENSMODG00000003921   Transcript: ENSMODT00000004908
Sequence length 248
Comment pep:novel chromosome:BROADO5:6:226398729:226468621:-1 gene:ENSMODG00000003921 transcript:ENSMODT00000004908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVRAPPPPPPRPQPWRLLSPTLPDKGNGFTRPKRQAKPAADEGFWDCSVCTFRNSAEAFK
CSICDVRKGTSTRKPRINSQLVAQQVAQQYATPPPPKKEKKEKVEKQEKEKPDKEKEISP
SVTKKNTNKKTKPKSDILKDPPSEANSIQSGNATTKTSDSNHTSRPRLKNVDRSTAQQLA
VTVGNVTVIITDFKEKTRSSSTSSSTVTSSAGSEQQNQSSSGSESTDKGSSRSSTPKGDM
SAVNDESF
Download sequence
Identical sequences F6YTS0
ENSMODP00000004805 ENSMODP00000004805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]