SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004822 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004822
Domain Number 1 Region: 356-527
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-58
Family SPRY domain 0.0000466
Further Details:      
 
Domain Number 2 Region: 22-99
Classification Level Classification E-value
Superfamily RING/U-box 1.57e-20
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 121-176
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000198
Family B-box zinc-binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004822   Gene: ENSMODG00000003934   Transcript: ENSMODT00000004925
Sequence length 530
Comment pep:novel chromosome:BROADO5:2:258025491:258042086:1 gene:ENSMODG00000003934 transcript:ENSMODT00000004925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVGPRSGPSAGAEALALAAELHGEATCSICLELFQDPVSIECGHSFCRSCIARCWERP
GIPVSPAPRALPCPQCREPARPSQLRPNRQLAGVASLLRRYSLSPSGDGDGEGAGSLVSG
CVQHGEPLKLYCQDDGRAICVVCDRAREHRAHAVLPLDEAVQEAKEMLESRLGALKKELE
EFEDFKSMEEKESRELLKQVTVEREKVGAEFQALRAFLMEQESRLVGRLEELAREVTQRQ
TENLNQLVSEISLLSKLTTEMEETSHKPDLDFLQEFKNTLGRCDNVPGPKPASVSSEMKS
KVWNISLKTFVLKGLLKKFKEDLRGELEKEEKDRSLYQAHWGGETEERKKHGPCPWRAPV
ELTLDPDTANPRLILSLDLKSVRLGPRPQDLPPNPRRFDTNTRVLASRGFSSGRHHWEVE
VGSADGWAFGVARESVRRKGLTPFTPEEGVWALQLNGGQYWAVTSPERTSLSPGGRLARV
RVALDLEAGAVSFYAAEDMRHIYTFRVAFRERVFPLFSVCSTGTYLRIWP
Download sequence
Identical sequences F7GIS6
ENSMODP00000004822 ENSMODP00000004822 XP_007483391.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]