SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004868 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004868
Domain Number 1 Region: 47-246
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.38e-30
Family Laminin G-like module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004868   Gene: ENSMODG00000003958   Transcript: ENSMODT00000004972
Sequence length 1917
Comment pep:novel chromosome:BROADO5:1:451294523:451576579:-1 gene:ENSMODG00000003958 transcript:ENSMODT00000004972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPAQLNFTGLQSSWDILSLFKPRGLLLTWIVFCSTCGLAFTQGDPEDVDVLQRLGLTGK
KSAGGRAPGLAPIPPGVIPFQSGFIFTQRTRIEAPTGAIIPAAFGTDLTLVLSLCSHRVN
NAFLFAIRSSRKKLQLGVQFIPGKIVLYLGQRRSVAFSYDVHDGRWHHLAIRIRGQAVTL
ITSCGKHQLPMDLHFKKDESLDPEGSFLFGKMNQHSVQFEGAVCQFNIYPSAKAAHNYCT
YLKKQCRQADTYRPLLPPLLPLLPQDPGLQTDPSLQSLRNLTTVMPPLASFRTAKTPQAL
PRAPGKGAKMTMVPSALTSPGLAVPPRQPVRTSTAVPRSSRSTAMSSLVLTIPVTERPSP
LSSGKASSSGLRPALPTSQSSSTKPPIHARKPVPPTPKASVVQTPHIPVKPVTPSITVAP
TKRPHPMVKAALTSPSKSFPSPMKPVLHGPRPVPARAPLPPTVKSAPQHSGIAPAPPTAR
PVPPAVRASLPVATKTASQGSRANMARTLPSTSKPAWAYTGTAKPAHPSVKPSLPASGPR
LAQTLRPPGKPVLPTTGIRLPGTMPPTIHPGSPPGLNSTGSKRVAEPPVKRKSSPKSTPW
PPSLPGPRKAAEAATTVSFSPSLKNLTARPIPKQAQLALTAAMVPTQHPPSNSQFVGAVT
LSHTDGYLFFDPIGPTLFPLLLGPPGQKGDPGFPGPPGLPGLPGLSGRRGPRGPPGPHGN
PGPPGPPGAKGQKGDPGLSPGKAYDGEKGDIGLSGLTGTLGPIGRKGLKGYPGPPGHPGD
QGQPGPEGSPGAKGYPGRQGLPGPIGEPGPKGSRGYIGLPGLFGLPGLDGERGQPGVHGK
RGKMGRPGFPGDFGERGPPGLDGNPGELGAPGPPGVHGLIGDMGAIGPIGYPGPKGMKGL
MGNIGEHGLKGDKGDQGLPGVPGDIGFQGDKGSQGMSGSPGARGKPGPPGKSGDKGPVGF
PGPPGPEGFPGDIGPPGQNGPEGAKGKPGARGLPGPRGQLGQEGDEGPMGPPGSPGLEGQ
LGRKGFPGRPGPDGSKGEPGNAGRPGRVGEQGLMGFIGLVGEPGIVGEKGGRGAMGPPGA
PGAKGSMGHPGTAGGVGDPGDPGPPGPPGTRGPLGLRGAKGRRGPRGPDGPAGEQGSQGV
KGPPGTQGKQGLDGQQGQEGERGEMGPRGFPGIPGPSGPPGAKGIPGEPGPQGPQGLIGP
LGEIGLKGPPGALGEPGLPGEAGMKGDFGPLGIPGEQGLIGQRGETGLEGDSGPAGPDGL
KGDKGEPGPDGERGEKGKEGLKGKEGPPGYPGVTGVRGPEGKPGKQGEKGRTGPKGAKGY
QGHLGEMGVSGEPGPAGNQGPKGSRGTLGPTGAPGRMGAQGEPGLPGYDGHKGLQGPLGP
PGPKGEKGEQGDDGKTEGPPGPPGDRGPVGDHGDRGEPGDPGYPGQEGLEGSRGKAGQQG
LPGHPGPRGRPGPKGSKGEEGQKGKQGKRGEAGSRGMQGLVGMPGPRGVVGRQGQEGLPG
QDGVPGKDGRAGEQGEQGDDGEVGPFGPAGRRGNPGVAGLPGAQGPPGFKGENGLPGQLG
PIGKRGTEGGTGLPGSQGEPGSKGQPVRGCHLRKGVSGLTGGQELLSPFSGSGIVYSLAI
FHLQGKEGVIGPLGILGPSGIPGPKGNKGSRGDLGLQGPRGPPGPRGRPGPPGPPGIPMS
FQQDDLGAAFQTWMDSNSALRTEGYSHSDLLVLDQGGEIFKTLHYLSSLIQSIKKPLGTK
ETPARICRDLMNCEQKMTDGTYWIDPNLGCSSDTIEVTCNFTKGGQTCLRPITASKVEFA
IGRVQMNFLHLLSSEVIQHITIHCLNMSVWQQGTGQVSPHHAVRFRAWNGQIFEAGGQFE
PEVSSDDCKVQDGRWHQTLFTFRTQDPSQLPIVSVYNLPPATPGKQYRLEVGPACFL
Download sequence
Identical sequences F7FYR1
ENSMODP00000004868 ENSMODP00000004868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]