SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004876 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004876
Domain Number 1 Region: 424-501,529-624
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-50
Family SPRY domain 0.0000913
Further Details:      
 
Domain Number 2 Region: 11-51,176-208
Classification Level Classification E-value
Superfamily RING/U-box 7.63e-18
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 217-278
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.36e-17
Family B-box zinc-binding domain 0.00076
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000004876
Domain Number - Region: 259-325
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0405
Family Apolipoprotein A-I 0.012
Further Details:      
 
Domain Number - Region: 503-537
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 0.0693
Family Obg GTP-binding protein N-terminal domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004876   Gene: ENSMODG00000003964   Transcript: ENSMODT00000004980
Sequence length 627
Comment pep:novel chromosome:BROADO5:2:257967453:257984231:-1 gene:ENSMODG00000003964 transcript:ENSMODT00000004980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVAMTPNPVQTLQEEAVCAICLDYFTDPVSIGCGHNFCRVCVTQLWGGEEEEDREEEE
DEGEEEEVEAVGASGGWDTPMREDEYEGDMEEEEVEEEEDEEFWTNSINGPTWDNMDYVW
DEDEEEDLDYYLGDVEEELRGEEEEEDEDEEVLEEDEEEELEPATPPPPAPAPRRRFTCP
QCRKTFPRRSFRPNLQLANMVQVIRQMHPAPRRGSRGNEQGVCPKHQEALKLFCEVDEEA
ICVVCRESRNHKQHSVVPLEEVVQEYKAKLQGHVEPLRKHLEAVQKLKAKEERRVTELKS
QMKTELAAVASEFGRLARFLADEQAGLERRLREQHEAQLGRAGAAAGRLGEQATQLSRLL
AEAQERSQQGGLRLLKDIKETFNRCEEVQLQPPEIWSPDPSHPHSHDFLTDAIVRKMSRM
FCQAARVDLTLDPDTAHPALALSPDRRGVRLAERRQELPDHPKRFSAECCVLGAQGFRSG
RHYWEVEVGGRRGWAVGAARESTRHKEKGGPGGGSGGGSGDATPSRHHHRRRRPHLPQQP
MFQREVWCVGTNGKRYQAQSSTEQTPLSPGDKPHRLGVYLDYEAGRLGFYNAETLGHVHT
FSAAFLGERVFPFFRVISKGTRIKLCP
Download sequence
Identical sequences F7FMU1
13616.ENSMODP00000004876 ENSMODP00000004876 XP_001372311.1.35504 ENSMODP00000004876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]