SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004880 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004880
Domain Number 1 Region: 927-1031
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-30
Family Calponin-homology domain, CH-domain 0.00013
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000004880
Domain Number - Region: 659-747
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0154
Family Myosin rod fragments 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004880   Gene: ENSMODG00000003967   Transcript: ENSMODT00000004984
Sequence length 1033
Comment pep:novel chromosome:BROADO5:Un:54076825:54090783:1 gene:ENSMODG00000003967 transcript:ENSMODT00000004984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKASRTSVSAPKVPAAAKSKPDSPTGARLSRPGSAPLAKAKSNDDLLAGMAGGAPGANS
MKGKKTCPVTASTSSLSVASASDSKTKTGPGTISKRNPSVGSRDLGSSCSRERLRERSRP
SLGRRVPAAGQNPGDPTAASTKRSRSRGGRDTDVRMSKSKSDNQISDRVALETRVQELLR
LAQAKEEEIVHLRDQLHALRLRLGLPEEEPPEAVLPPDRDADVRQKLGRLKSENRMLRDR
LDALGFSPDDGPLPMVAVAGGSPGDGGVLGSSTEGSALGSLEDLLNPDEPAPMDTPGSGE
EGPGPWRSPSPPTEAVSAVACLTERLQQMEENQHSTSEELQATLQELADLQQISQELGGE
NERLGEERLLLLQSLGQQSERLELLGRQVEYLRSLLDEHHVAYVLDEDVRSGRYLELEQR
FLELAENARFEREQLLGVQQHLSAALHLAEQDAQDGQELIRALKERNLHMERALEAEQKN
AASLAAALEQQQATVASDQLELGRLRTQLESEKQRVAELYSLHSAGDKSDIQDLLDSVRQ
EKDKAEALAGSLQEDLTHARADVTRLQDTITKIQDESRGFQEEAQKKMGELNVQLEKLRS
ELEEKETERGDMKETIFELEDEVEQHRAVKLHDNLVISDLENTVKKLQDQKHDMDREVKT
LHRRLREESAEWRQFQADLQTAVVIANDIKSEAQEEVGDLKRRLQEAQEKNEKLSKELDE
VKSRKQEEERGRVYNYMNTVERDLAALRQGMGLGRSSSASSEPAPTVKTLINSFDSASSP
QGAGPAGILLSMVATKSNYTPPSSTISPSWRPECPLWGLGEPQRVHRFEPGGPRVPAGRG
TSPLGQLFMPAASSSPPSAPPRRSSEDVKRDMTASDGPSTASLMAMGPSSPQLAHPSPTA
SVTPTARSRIREERKDPLSALAREYGGSKRNALLKWCQKKTEGYQNIDITNFSSSWNDGL
AFCALLHTYLPAHIPYQELSGLDKKRNFSLAFQAAESVGIKSTLNISEMARTERPDWQSV
MQYVTAIYKYFET
Download sequence
Identical sequences H9H640
ENSMODP00000004880 13616.ENSMODP00000004880 ENSMODP00000004880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]