SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004940 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004940
Domain Number 1 Region: 154-436
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.03e-82
Family Eukaryotic proteases 0.00000042
Further Details:      
 
Domain Number 2 Region: 40-103
Classification Level Classification E-value
Superfamily GLA-domain 3.14e-24
Family GLA-domain 0.00022
Further Details:      
 
Domain Number 3 Region: 92-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000838
Family EGF-type module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004940   Gene: ENSMODG00000004015   Transcript: ENSMODT00000005046
Sequence length 442
Comment pep:novel chromosome:BROADO5:7:77901032:77934447:-1 gene:ENSMODG00000004015 transcript:ENSMODT00000005046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSRSCMVQFLGFMLMLHQSLTSVFLNQEEANNVLKRERRANSFLEELRSGSLERECIEE
KCSFEEALEIFKSKERTKQFWIYYNDGDQCASNPCQNGGTCVDQFQSYICFCPARFEGRN
CETDKDSLLICKYENGGCDQYCLDNPETVRQCHCEPGYALAPDGVSCNPVVDYPCGRIPV
LEKRNRSIPEGRIVGGNACPKGECPWQALILLKNELLCGGTLLTDTWVVSAAHCFDKLSH
GFQNSVTVVLGEHKIDKDEGTEQKRNVADIIIHKQYVRLKINHDIALVRLQKPVNFTDYV
VPLCLPEKAFSENHLAYIRFSSVTGWGQLLDRGVTSLELMMIKVPRLKTQDCLEQMKRTP
QTPAITENMFCAGFLDGTKDSCKGDSGGPHATKYKGTWYLTGIVSWGEGCASVGHYGIYT
RVSKYIDWLNTHINPNSSFSVS
Download sequence
Identical sequences F7D6Z7
ENSMODP00000004940 XP_001374277.2.35504 ENSMODP00000004940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]