SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004969 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004969
Domain Number 1 Region: 316-760
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.61e-68
Family Tandem AAA-ATPase domain 0.016
Further Details:      
 
Domain Number 2 Region: 843-909
Classification Level Classification E-value
Superfamily R3H domain 0.0000000000000667
Family R3H domain 0.00049
Further Details:      
 
Domain Number 3 Region: 1011-1065
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.000000000000863
Family AN1-like Zinc finger 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004969   Gene: ENSMODG00000004040   Transcript: ENSMODT00000005076
Sequence length 1125
Comment pep:novel chromosome:BROADO5:5:303651238:303671481:1 gene:ENSMODG00000004040 transcript:ENSMODT00000005076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGTRSIVQDQGIKGQGMNATVGLRGELRGAGEGGVEGGPALFSPAPGLAPSPATATLGI
AGRPRLRPAGRNRRPTRAPKAARAAAVAAAAILLPLPLPGRPAANGSSHRQELPEGAGFP
CGSGAGVMAAVESFVSCQLKLLELEREAELQEKRTWQESVAPKELQRRGVCLLKLRVSSQ
RTGLYGRLLVVLEPRTGEPGAPLPCNNFGPGDIVGLYEGAAETEQLATGILTRITQRSVT
VAFDESPESSLALDPSSSYRLLRLANDVTYKRLKKALVTLKQYHSGPAASLIDVLLGTSE
PSSPALTRPLTFCNGSLDTSQKEAVGFALAQKELAIIHGPPGTGKTTTVVEIILQAVQQG
LKVLCCAPSNIAVDNLVERLAAQKQRVLRLGHPARLLDAIQHHCLDAVLARSDQAQIVAD
IRKDIDQVKSKKTQERRDKNSCRNEMKLLRKELREREEAAMLASLTGADVILATNTGASP
DGPLKLLPEDYFDVVVIDECAQALEASCWIPLLRARKCILAGDHQQLPPTIMSKQAATGG
LYLSLMERLIKKHGEQVVRMLTVQYRMHQAIMQWASEELYHGRLSAHASVASHLLKDLPG
VTPTEETSIPLLLIDTAGCGLFELEEEDEQSKGNPGEVQLVSLHVQALVAAGVRVGDIAV
IAPYNLQVDLLRQQLSPRYPELEIKSVDGFQGREKEAIVLSFVRSNRKGEVGFLAEDRRI
NVAVTRARRHVAIICDSRTVSSDAFLKKLVEYFSLKGEARTAFEYLEDIVPDNYSHEGPQ
GPSQAAGKPGDPARPGPRPRQDRQKARGARKANRSGPPGQMPAGPGVSDGGQPEGTADPF
RTMIVDFLESSKTLLEFPASLNAHDRMLVHQLAEEHGLKHESVGEGKKRYISVRKKCTAA
PPTPTAAAAAPTSVALSPAGMETEGQEELQPGSPGPGMPCHALGEQDTPSSSENGLSQKG
QDWEGGQMGKARPGQPARQRQDTTGSRAPKAPGRKKAKERKGHTGMNGTTEEDFDALVSA
AIRADNTCWLPGCKASVVTLGQLCLHCGQRFCLSHHIPEVHGCGEEGSSTTPGRGSAEKG
SCTPAVEPRTRPWTPVKRVHLQRRLDKKLGELSSQRRSKKKDKDK
Download sequence
Identical sequences F7CMA5
ENSMODP00000004969 ENSMODP00000004969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]