SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000004999 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000004999
Domain Number 1 Region: 153-261
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-26
Family Cadherin 0.00025
Further Details:      
 
Domain Number 2 Region: 262-377
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-25
Family Cadherin 0.00075
Further Details:      
 
Domain Number 3 Region: 373-496
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-24
Family Cadherin 0.0051
Further Details:      
 
Domain Number 4 Region: 482-587
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-18
Family Cadherin 0.0029
Further Details:      
 
Domain Number 5 Region: 78-160
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000143
Family Cadherin 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000004999   Gene: ENSMODG00000004059   Transcript: ENSMODT00000005106
Sequence length 764
Comment pep:novel chromosome:BROADO5:3:126302036:126594308:-1 gene:ENSMODG00000004059 transcript:ENSMODT00000005106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTIYQVILLFLLWVCLPNFSSTEMLFRRTSEPQSKIVKARTPGRDGKVLHRQKRGWMWNQ
FFLLEEYTGSDYQYVGKLHSDQDKGDGSLKYILSGDGAGTLFIIDEKTGDIHATRRIDRE
EKAFYTLRAQAINRRTLRPVEPESEFVIKIHDINDNEPTFPEEIYTASVPEMSVVGTSVV
QVTATDADDPSYGNSARVIYSILQGQPYFSVEPETGIIRTALPNMNRENREQYQVVIQAK
DMGGQMGGLSGTTTVNITLTDVNDNPPRFSQNTIHLRVPESSPVGTAIGSVKATDADTGK
NAEIEYRIIDGDGTDMFDIITQKDTQEGILTVRKPLDYESRRLYTLKVEAENTHVDPRFY
YLGPFKDTTIVKISVEDVDEPPVFSRSSYLFEVHEDIEVGTIIGTVMARDPDSASSPIRF
SLDRHTDLDRIFNIHSGNGSIYTSKPLDREISQWHNLSVIAAEINNPKETTRVAVFVRIL
DVNDNAPQFAVFYDTFVCENARPGQLIQTISAVDKDDPLGGQKFFFSLAAVNPNFTVQDN
EDNTARILTRKNGFSRHEISSYLLPVVISDNDYPIQSSTGTLTIRVCACDNQGNMQSCSA
EALLLPAGLSTGALIAILLCIIILLVIVVLFAALKRQRKKEPLILSKEDIRDNIVSYNDE
GGGEEDTQAFDIGTLRNPAVIEDKKLRRDIIPETLFIPRRTPSAPDNTDVRDFINERLKE
HDIDPTAPPYDSLATYAYEGNDSIAESLSSLESGCHMEYIQHFI
Download sequence
Identical sequences F7BIQ7
ENSMODP00000004999 ENSMODP00000004999 XP_001364775.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]