SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005003 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005003
Domain Number 1 Region: 239-319
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000136
Family DEATH domain, DD 0.032
Further Details:      
 
Domain Number 2 Region: 135-192
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000016
Family TNF receptor-like 0.0023
Further Details:      
 
Domain Number 3 Region: 66-113
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000255
Family TNF receptor-like 0.0031
Further Details:      
 
Domain Number 4 Region: 326-401
Classification Level Classification E-value
Superfamily DEATH domain 0.0000386
Family DEATH domain, DD 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005003   Gene: ENSMODG00000004064   Transcript: ENSMODT00000005110
Sequence length 433
Comment pep:novel chromosome:BROADO5:3:391970573:392013466:-1 gene:ENSMODG00000004064 transcript:ENSMODT00000005110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPARRRERASEQALYCLSAFPAPGVSLETTMNKFLCCTLVFLDISVKWTTQETFPPKY
LHYDPETSRQLLCDQCPPGTYLKQHCTTRRRTQCEPCPHHYYTESWHFSEECLYCSGVCK
ELQHVKQECNSTHNRVCECMEGRYLELEFCLRHTSCPPGFGVVQAGTPERNTICKRCPDG
FFSNETSSKAPCRKHTNCSALGLRMASKGNATHDNLCSGNTEGTQKCGIDVTLCEEAFFR
FAFPTKFTPNWLSVLVDSLPGTKVNAEMIERIKRRHSSQEQTFQLLKLWKHQNKDQGMVK
KIIQDIDLCENSVVKHIGFLNLTLEQLRSLMESLPGKKVGLEDIEKTMKLCKSTDQVLKL
LNLWRIKNGDQDTLKGLAHGLKHLKTYHFPKVVLQSLRKTVKFLHSFTMYRLYQKLFLEM
IGNQVQSGKISCL
Download sequence
Identical sequences F6VWG6
XP_001380987.1.35504 ENSMODP00000005003 ENSMODP00000005003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]