SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005061 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005061
Domain Number 1 Region: 1069-1406
Classification Level Classification E-value
Superfamily NHL repeat 4.71e-25
Family NHL repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 764-839
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000314
Family Pre-dockerin domain 0.073
Further Details:      
 
Domain Number 3 Region: 1374-1554
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.000000667
Family DPP6 N-terminal domain-like 0.031
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000005061
Domain Number - Region: 516-540
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000514
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 582-606
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000574
Family Integrin beta EGF-like domains 0.051
Further Details:      
 
Domain Number - Region: 612-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000586
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 639-678
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00179
Family EGF-type module 0.06
Further Details:      
 
Domain Number - Region: 448-475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00227
Family Integrin beta EGF-like domains 0.029
Further Details:      
 
Domain Number - Region: 483-507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00502
Family Integrin beta EGF-like domains 0.049
Further Details:      
 
Domain Number - Region: 418-442
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00945
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 2126-2254
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.053
Family SGL-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005061   Gene: ENSMODG00000004107   Transcript: ENSMODT00000005170
Sequence length 2603
Comment pep:novel chromosome:BROADO5:5:82923090:83358371:-1 gene:ENSMODG00000004107 transcript:ENSMODT00000005170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSSSSPSVIEHTHSPPPSPNLHDNQRWLLSTSAIQPVQDSDTDDEYIASSFLVQTGTV
SVCAPCDEQPANNQGQSTLQPLPPSHKQHSAQHHPSITSLNRNSLTNRRNQSPAPPAALP
AELQTTPESVQLQDSWVLGSNVPLESRHFLFKTGTGTTPLFSTATPGYTMASGSVYSPPT
RPLPRNTLSRSAFKFKKSSKYCSWKCTALCAVGVSVLLAILLSYFIAMHLFGLNWQLQQT
ENDTFENGKVNSDTMPTNTVSLPSGDNGKLGGFAQENNTIDSGELDIGRRAIQEVPPGIF
WRSQLFIDQPQFLKFNISLQKDALIGVYGRKGLPPSHTQYDFVELLDGSRLIAREQRNLL
ESERAGRQTRSVSLHEAGFIQYLDSGIWHLAFYNDGKNVEQVSFNTIVIESVVECPRNCH
GNGECVSGTCHCFPGFLGPDCSRAACPVLCSGNGQYSKGRCLCFSGWKGTECDVPTTQCI
DPQCGGRGICIMGSCACNSGYKGENCEEADCLDPGCSNHGVCIHGECHCNPGWGGNNCEI
LKTMCPDQCSGHGTYLQESGTCTCDPNWTGPDCSNEICSVDCGSHGVCMGGTCRCEEGWT
GPACNQRACHPHCAEHGTCKDGKCECSQGWNGEHCTIEGCPGLCNSNGRCTLDPNGWHCV
CQPGWRGAGCDVAMETLCTDSKDNEGDGLIDCMDPDCCLQSSCQNQPYCRGLPDPQDIIS
QSLQSPSQQAAKSFYDRISFLTGPDSTHVIPGESPFNKSLASVIRGQVLTADGTPLIGVN
VSFFHYPEYGYTITRQDGMFDLVANGGASLTLVFERSPFLTQYHTVWIPWNVFYVMDTLV
MKKEENDIPSCDLSGFVRPNPIIVSSPLSTFFRSSPEDSPIIPETQVLHEDTTIPGTDLK
LSYLSSRAAGYKSVLKITMTQSVIPFNLMKVHLMVAVVGRLFQKWFPASPNLAYTFIWDK
TDAYNQKVYGLSEAVVSVGYEYESCLDLTLWEKRTAILQGYELDASNMGGWTLDKHHVLD
VQNGILYKGNGENQFISQQPPVVSSIMGNGRRRSISCPSCNGQADGNKLLAPAALACGID
GSLYVGDFNYVRRIFPSGNVTSVLELRNKDFRHSSNPAHRYYLATDPVTGDLYVSDTNTR
RIYRPKSLTGAKDLTKNAEVVAGTGEQCLPFDEARCGDGGKAVEATLMSPKGMAIDKNGL
IYFVDGTMIRKVDQNGIISTLLGSNDLTSARPLTCDTSMHISQVRLEWPTDLAINPMDNS
IYVLDNNVVLQITENRQVRIAAGRPMHCQVPGVEYSVGKHAVQTTLESATAIAVSYSGVL
YITETDEKKINRIRQVTTDGEISLVAGIPSECDCKNDANCDCYQSGDGYAKDAKLNAPSS
LAASPDGTLYIADLGNIRIRAVSKNKPLLNSMNFYEIASPTDQELYIFDINGTHQYTMSL
VTGDYLYNFSYSNDNDITAVTDSNGNTLRIRRDPNRMPVRVVSPDNQVIWLTIGTNGCLK
SMTAQGLELVLFTYHGNSGLLATKSDETGWTTFFDYDSEGRLTNVTFPTGVVTNLHGEMD
KAITVDIESSSREEDVSITSNLSSIDSFYTMVQDQLRNSYQIGYDGSLRIIYASGLDSHY
QTEPHVLAGTANPTVAKRNMTLPGENGQNLVEWRFRKEQAQGKVNVFGRKLRVNGRNLLS
VDFDRTTKTEKIYDDHRKFLLRIAYDTSGHPTLWLPSSKLMAVNVTYSSTGQIASIQRGT
TSEKVDYDGQGRIVSRVFADGKTWSYTYLEKSMVLLLHSQRQYIFEYDLLDRLSAITMPS
VARHTMQTIRSIGYYRNIYNPPESNASIIMDYNEEGLLLQTAFLGTSRRVLFKYRRQTRL
SEILYDSTRVSFTYDETAGVLKTVNLQSDGFICTIRYRQIGPLIDRQIFRFSEDGMVNAR
FDYSYDNSFRVTSMQGVINETPLPIDLYQFDDISGKVEQFGKFGVIYYDINQIISTAVMT
YTKHFDAHGRIKEIQYEIFRSLMYWITIQYDNMGRVTKREIKIGPFANTTKYAYEYDVDG
QLQTVYLNEKIMWRYNYDLNGNLHLLNPSNSARLTPLRYDLRDRITRLGDVQYRLDEDGF
LRQRGTEIFEYSSKGLLTRVYSKGSGWTVIYRYDGLGRRVSTKTSLGQHLQFFYADLTYP
TRITHVYNHSSSEITSLYYDLQGHLFAMEISSGDEFYIASDNTGTPLAVFSSNGLMLKQI
QYTAYGEIYFDSNLDFQLVIGFHGGLYDPLTKLVHFGERDYDILAGRWTTPDIEIWKRIG
KDPAPFNLYMFRNNNPASKIHDVKDYITDVNSWLVTFGFHLHNAIPGFPVPKFDLTEPSY
ELVKSQQWDDIPPIFGVQQQVARQAKAFLSLGKMAEVQISRRKAGGEKSWLWFATVKSLI
GKGVMLAVSQGKVLTNVLNVANEDCIKVAAVLNNAYYLENLHFTIEGKDTHYFIKTTTPE
SDLGTLRLTSGRKALENGINVTVSQSTTVVNGRTRRFADVEMQYGALALHVRYGMTLDEE
KARILEQARQRALANAWAREQQRVRDGEEGARLWTEGEKRQLLSAGKVQGYDGYYVLSVE
QYPELADSANNIQFLRQSEIGRR
Download sequence
Identical sequences F6VE35
ENSMODP00000005061 ENSMODP00000005061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]