SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005221 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005221
Domain Number 1 Region: 147-275
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-28
Family Cadherin 0.00019
Further Details:      
 
Domain Number 2 Region: 372-492
Classification Level Classification E-value
Superfamily Cadherin-like 1.24e-23
Family Cadherin 0.0042
Further Details:      
 
Domain Number 3 Region: 261-376
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-23
Family Cadherin 0.00091
Further Details:      
 
Domain Number 4 Region: 481-589
Classification Level Classification E-value
Superfamily Cadherin-like 4e-16
Family Cadherin 0.0014
Further Details:      
 
Domain Number 5 Region: 75-159
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000157
Family Cadherin 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005221   Gene: ENSMODG00000004237   Transcript: ENSMODT00000005334
Sequence length 789
Comment pep:novel chromosome:BROADO5:3:131015064:131271489:-1 gene:ENSMODG00000004237 transcript:ENSMODT00000005334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTCSCLSLFLWTYMFQVVESTQLQEKMSRYLQKGKILSLSEDNGKMLHRTKRGWMWNQF
FLLEEYTGTDTQYVGKLHTDQDKGDGNLKYILTGDGAGSLFIIDENTGDIHAAKKLDREE
KSLYVLRAKAIDRKTGRQVEPESEFIIKIHDINDNEPKFTKDLYTASVPEMSGVGTSVIQ
VLATDADDANYGNSAKIVYSILQGQPYFSVDPESGIIKTALPDMSRENREQYQVVIQAKD
MGGQMGGLSGTTTVNITLTDVNNNPPRFPQSTYQFSSSESVSLGTPLGRIKANDPDVGEN
AEMEYSLVEGDGSNMFDIITDKDTQEGIITVKKQLDFEKKMLYTLRIEASNTHPDPRFQH
LGPFKDTAVVKISVEDVDEPPIFSKPFYLIEVDEDVKEGSIIGQVIAYDPDAIKNLIKYS
VDRHTDMDRIFNIHSGNGSIFTLKPLDREAYPWHNISITASEINNPKQSSHISVFIRILD
INDHAPEFAKYYETFVCENAKPGELIQTISVMDKDDPPRGHKFFFEPVPEFPLNPNFTIV
DNKDNTAGVLTRKDGYSRHKMSTYLLPILIFDNDYPIQSSTGTLTIRVCACDNQGNMQSC
NAEALILSAGLSTGALIAILLCILILLILVVLFAALKRQRKKEPLIISKDDVRDNIVTYN
DEGGGEEDTQAFDIGTLRNPEAREDSKLRRDVIPETIFQIRRTAPLWENIDVQDFIHRRL
KENDLDPSAPPYDSLATYAYEGNDSIADSLSSLESLTADGNQDYDYLSDWGPRFKKLADM
YGGDDSDHD
Download sequence
Identical sequences F6UBJ7
ENSMODP00000005221 ENSMODP00000005221 13616.ENSMODP00000005221 XP_001374843.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]