SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005229 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005229
Domain Number 1 Region: 91-189
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.63e-20
Family Ubiquitin-related 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005229   Gene: ENSMODG00000004243   Transcript: ENSMODT00000005342
Sequence length 245
Comment pep:novel chromosome:BROADO5:8:215665716:215668403:-1 gene:ENSMODG00000004243 transcript:ENSMODT00000005342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALIEGVGDEVTVLFGALLCLLVLGLAWISTHTSEQGDLLPPDSGTPSPTQSREAAVSTV
SNNQDASGSEAPTLRHRVPSLQSEPGRVSPEAPPPSSQPGPLVLRLKFLNESEQVARAWP
QDTIGSLKRTQFPGQEHLVRLIYQGQLLGDDAQTLGSLHLPPNCVLHCHIAPRDGPQHLG
CPPGSETDPSGLGVGNLLLPLLLLMLTLLWYCQIQYRPFFPPTATLGLAGLTLLVSLLAF
AMYRR
Download sequence
Identical sequences F6UBD7
ENSMODP00000005229 ENSMODP00000005229 XP_001371527.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]