SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005405 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005405
Domain Number 1 Region: 79-302
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.63e-72
Family Lectin leg-like 0.0000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005405   Gene: ENSMODG00000004386   Transcript: ENSMODT00000005522
Sequence length 382
Comment pep:novel chromosome:BROADO5:1:383377474:383386845:1 gene:ENSMODG00000004386 transcript:ENSMODT00000005522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPEGGRKEDGSWGEARRMAAGAAAKLCTIWGWRWGCQSSRMVGSLSPFPSVLLLILLLL
LSPAPQPAASDITNGNNEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYIRLTPDE
PSKEGSIWNHQPCFLKDWEMHVHFKVHGIGKKSLHGDGFALWYTRDRLMPGPVFGSKDNF
HGLAIFLDTYPNDESTERVFPYISVMVNNGSLKYDHSKDGRWTELAGCTADFRNQNHDTF
LAVRYSRGRLTVMTDVEDKNEWKNCIDISGVQLPTGYYFGASAGTGDLSDNHDIISMKLF
QLMVEHTPEEDNIDWTKIEPSVSFLKSPKDNVDDPTGNFRSGPLTGWKVFLLLLCALLGI
IVCAVVGAVVFQKRQERNKRFY
Download sequence
Identical sequences F6SVV5
ENSMODP00000005405 ENSMODP00000005405 XP_001381091.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]