SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005420 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000005420
Domain Number - Region: 62-105
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0294
Family Cna protein B-type domain 0.017
Further Details:      
 
Domain Number - Region: 132-174
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0523
Family Myosin rod fragments 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005420   Gene: ENSMODG00000004399   Transcript: ENSMODT00000005537
Sequence length 216
Comment pep:novel chromosome:BROADO5:5:236252928:236276666:1 gene:ENSMODG00000004399 transcript:ENSMODT00000005537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAHIILSLFSFMSMSSAFYFHVAEREEKCIIEDIPSDTLITGTYKVEQWDIKRQDFLGS
APGLGMFVTVTTYNDEVLLSRLYGSQGVFTFTSYSPGEHIICLESNSTNLISFGGSKLRI
HLDIRIGEHDLDAVIAQAKDKVNEVNYKLEHLTEQIEQIIKEQNYQREREENFRMTSEDT
NSSVLWWALAQMLILILVGIFQMKSLKDFFIAKKLV
Download sequence
Identical sequences F6SVK5
XP_001376145.2.35504 ENSMODP00000005420 ENSMODP00000005420 13616.ENSMODP00000005420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]