SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005423 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005423
Domain Number 1 Region: 229-395
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-42
Family SPRY domain 0.00026
Further Details:      
 
Domain Number 2 Region: 16-75
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000259
Family B-box zinc-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005423   Gene: ENSMODG00000004402   Transcript: ENSMODT00000005540
Sequence length 400
Comment pep:novel chromosome:BROADO5:1:452713917:452729120:-1 gene:ENSMODG00000004402 transcript:ENSMODT00000005540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEKEPDQAPGPPEDSAPRCPEHDLELKWFCSSERRLVCASCKGLGGPCREHHVRRAEER
AEELRNKIVDQCEKLQLQSAGITKYMAEVLPRKNQNAATLASGAREIVIQRLGLVKNVCE
SEEQRLLEQVHTEEERAHQSILTQRSHWTEALQKLSTIRTNLVSMLTDLDDRSLVQSERE
IFERTEEAEGILDPQESEKLNFNQKCVRSPLLTQLWASAVLCCLSGTEDIQVDERTISPF
LRLSEDRKTLTFNPKKSKAYADGPERFDHWPNALASTSFQGGLHAWIVNVENSCAYKVGV
SSSQLPRKGSGSDTRLGHNAFSWVFSRYDQEFRFLHCGQYQPLALLRCPDRIGVLLDLAA
GELLFYEPTSGALLCSYHAQFEGPIFPVFAVADQKISIVQ
Download sequence
Identical sequences F6SVI5
ENSMODP00000005423 ENSMODP00000005423 XP_001364233.1.35504 13616.ENSMODP00000005423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]