SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005449 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005449
Domain Number 1 Region: 37-840
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.49e-296
Family Motor proteins 7.19e-17
Further Details:      
 
Domain Number 2 Region: 1234-1351
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.1e-27
Family Myosin rod fragments 0.004
Further Details:      
 
Domain Number 3 Region: 838-962
Classification Level Classification E-value
Superfamily Myosin rod fragments 2.88e-27
Family Myosin rod fragments 0.000000595
Further Details:      
 
Domain Number 4 Region: 960-1071
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.22e-24
Family Myosin rod fragments 0.001
Further Details:      
 
Domain Number 5 Region: 1429-1551
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000000889
Family Myosin rod fragments 0.0062
Further Details:      
 
Domain Number 6 Region: 1628-1743
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000034
Family Myosin rod fragments 0.0075
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000005449
Domain Number - Region: 1069-1182
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000628
Family Myosin rod fragments 0.005
Further Details:      
 
Domain Number - Region: 1807-1911
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00112
Family Myosin rod fragments 0.008
Further Details:      
 
Domain Number - Region: 1554-1659
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00968
Family Myosin rod fragments 0.0049
Further Details:      
 
Domain Number - Region: 1351-1433
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0131
Family Myosin rod fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005449   Gene: ENSMODG00000004422   Transcript: ENSMODT00000005567
Sequence length 1936
Comment pep:novel chromosome:BROADO5:1:172769650:172864562:-1 gene:ENSMODG00000004422 transcript:ENSMODT00000005567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDAEMAAFGAAAPFLRKSEKERLEAQTRAFDLKKDVFVPDDKEEFVKAKIISREGGKVT
AETENGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYASWMIYTYSGL
FCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES
GAGKTVNTKRVIQYFAVIAAIGDRSKKEQTPGKGTLEDQIIQANPALEAFGNAKTVRNDN
SSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDM
LLITNNPYDYAFISQGETTVASIDDSEELMATDSAFDVLGFTPEEKNSIYKLTGAIMHFG
NMKFKQKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQV
SYAIGALAKSVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINF
TNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMF
PKATDMTFKAKLYDNHLGKSNNFQKPRNIKGKQEAHFSLIHYAGTVDYNILGWLQKNKDP
LNETVVGLYQKSSLKLLSNLFANYAGADAPVEKGKGKAKKGSSFQTVSALHRENLNKLMT
NLRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQ
RYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDER
LSRIITRIQAQSRGVLSRMEFKKILERRDSLLIIQWNIRAFMSVKNWPWMKLFFKIKPLL
KSAETEKEMATMKEEFGKLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLAD
AEERCDQLIKNKIQLEAKVKEQTERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELT
LAKVEKEKHATENKVKNLTEEMAGLDEIIVKLTKEKKALQEAHQQALDDLQAEEDKVNTL
TKAKVKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERL
KKKDFELNALNARIEDEQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLS
RELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSV
AELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHR
SKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQMEDLKRQLE
EEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAI
QRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAA
ALDKKQRNFDKILSEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKR
ENKNLQEEISDLTEQLGSSGKSIHELEKIRKQLEAEKLELQSALEEAEASLEHEEGKILR
AQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKMEG
DLNEMEIQLSHANRIAAEAQKQVKTLQGLLKDTQIQLDDAVRANDDLKENIAIVERRNNL
LQAELEELRAVVEQTERARKLAEQELIETSERVQLLHSQNTSLINQKKKMEADLSQLQSE
VEESVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEA
EQIALKGGKKQLQKLEARVRELENELESEQKRNVESVKGMRKCERRIKELTYQTEEDRKN
LLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKL
RAKSRDIGAKKMHDEE
Download sequence
Identical sequences F6SCX2
ENSMODP00000005449 ENSMODP00000005449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]