SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005611 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000005611
Domain Number - Region: 565-667
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00209
Family Myosin rod fragments 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005611   Gene: ENSMODG00000004554   Transcript: ENSMODT00000005730
Sequence length 1127
Comment pep:novel chromosome:BROADO5:1:240270088:240782347:1 gene:ENSMODG00000004554 transcript:ENSMODT00000005730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESSSESEYYLHSRLDWRKPHNRRDHAADVTAKIHTLTSTLQDTNRNLRQVDQMLGQYR
DYSNEQTEAIENLRETLEQSIGQLRSQRLLRNSGVRSASLSSLYVSDLDGPSATDSHHQF
WPSSPLRDSREPQGTRLQKSRSTCVRFLDQPDDLVQLHSLHQSVRDLSNEQARLGDDLNR
ELSRRNRSDAQTKKTLEELTVRLDESQRQDSVSERVEKRLQEIERVMQNERHLVEKRQEE
LGLMSLQLQEALRKQDANAGENGELMKTKLRQSENEKNQVEQELETSRRMLAQSECSRES
LLLQMEDLRVQLSKYQAPKVSRQQISQLDEHGDQRRIRRASEKSEWEKQELEKQVSELKA
KLNHNVMISEIQELKRCLEKKDKEKAQFEEQIEILSSDLERREKQQVRMLEQLAEIQKRY
EECESERIEANSHVKELVQQAEDSTKEAERYLSEFQRSEALRQESEKKKEEIKTKAQESI
RQWKLKYKALERDLEKQNENVLHLTEKNNQMLKEKDDLKVQLHLASCRNENLRQELNDVI
TKRADQEEELHSKERKLNDSKCRQKDLEQEIRTLKDSVHQLENELQRHIRLHGQITTAKD
YLEEEVADIKMAREKEKEKLSKFEETIKNLSAAREELVNKVAEEERAKKEALKKLSDLKK
MEGSSKEEMSTVIRQLKLERDVHQRELEDVRTELKNLTAKHERTIQEIKLQFKQEQCEIE
SHVRSLKTESLEDKNAVKIHRWQVEKMKVQCEKLAEELAQKEDENSKLKRKYHLVKQHLE
DKEKQLHRDEECVKRMEEIKIQLKDQLLAMETEQESIFDMLGKEIDVACEIFSRDSLDKF
KAISSTGDKHHDVRHDPHRWLAESKTKLQWLCEEAKEREDKEKKLKQQVLLYRHQLSDMT
QRRETEHQTLFDQIERQEQLLEEIHRERRDLLTKNQRKEEEMEYLQLKLLFKLPSWEDEN
QTPLTNENEAQFEDKADRVCALERSTQMALEHLESVPEKLNLLEDIKDFGDSSCPRDLIE
GRYAKYKQLVDSLQHQLDEYSQRIKKLKERKMNVSALTDQGEGLSPTWQARSRTLPHNSR
LSQTGSYIKKVIPLELISTKEDATNVTMNGIRSQAKKEKLNSNKKKM
Download sequence
Identical sequences F6R5G9
ENSMODP00000005611 XP_007472765.1.35504 XP_007472766.1.35504 XP_007472767.1.35504 ENSMODP00000005611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]