SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005676 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005676
Domain Number 1 Region: 1-303
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.39e-71
Family L-arabinose binding protein-like 0.000000856
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000005676
Domain Number - Region: 312-355
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0565
Family TNF receptor-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005676   Gene: ENSMODG00000004605   Transcript: ENSMODT00000005795
Sequence length 714
Comment pep:novel chromosome:BROADO5:6:239357111:240229870:1 gene:ENSMODG00000004605 transcript:ENSMODT00000005795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDIVKALGWNYVSTLASEGSYGEKGVESFTQISKEAGGLCIAQSVRIPQERKYKPSDFD
KIIKQLLDTPNSRAVVIFANDEDIKQILAAAKRADQLGHFLWVGSDSWGSKVNPLYQNED
IAEGAITIQPKRATVEGFDTYFTSRTLENNRRNVWFAEYWEENFNCKLTISGSKKEDTDR
KCTGQERIGKDSYYEQEGKVQFVIDAVYAMAHALHHMNKDLCADYPGVCPEMEQAGGKKL
LKYIRSVNFNGDAGTPVTFNKNGDAPGRYDIFQYQITNTTNPGYRLIGQWTDELQLNIDD
MQWGKGVREIPSSVCTLPCKTGERKKTQKGIPCCWTCEPCDGYQFQSDEMTCQHCPYDKR
PNENRTGCQDIPIVKLEWHSPWAVIPVFLAMLGIIATIFVMATFIRYNDTPIVRASGREL
SYVLLTGIFLCYIITFLMIAKPDVAVCSFRRVFLGLGMCISYAALLTKTNRIYRIFEQGK
KSVTAPRLISPTSQLAITSSLISVQLLGVFIWFGVDPPNIIIDYDEHKTVNPEQARGVLK
CDITDLQIICSLGYSILLMVTCTVYAIKTRGVPENFNEAKPIGFTMYTTCIVWLAFIPIF
FGTAQSAEKLYIQTTTLTISMNLSASVALGMLYMPKVYIIIFHPELNVQKRKRSFKAVVT
AATMSSRLSHKPSDRPNGEAKTELCENVDPNNSIPPVRKSVQKSVTWYTIPPTV
Download sequence
Identical sequences F6Y4H2
ENSMODP00000005676 13616.ENSMODP00000005676 ENSMODP00000005676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]