SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005726 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005726
Domain Number 1 Region: 22-216
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.42e-59
Family Astacin 0.0000993
Further Details:      
 
Domain Number 2 Region: 488-598
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.14e-37
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 3 Region: 649-755
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-37
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 4 Region: 338-441
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-36
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 5 Region: 223-332
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-35
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 6 Region: 779-872
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-28
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 7 Region: 596-640
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000301
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 8 Region: 443-485
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000791
Family EGF-type module 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005726   Gene: ENSMODG00000004648   Transcript: ENSMODT00000005847
Sequence length 883
Comment pep:novel chromosome:BROADO5:1:74960955:75046851:1 gene:ENSMODG00000004648 transcript:ENSMODT00000005847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKASPATPVESSPRVRRATTSRTERIWPGGVIPYVIGGNFTGHQRAIFKQAMRHWEKHTC
VTFIERTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGKNCDKFGIVAHELGHVVGFWH
EHTRPDRDQHVTIIRENIQQGKEYNFLKMEAGEVNSLGETYDFDSIMHYARNTFSRGVFL
DTILPRRDDNGVRPTIGQRVRLSQGDIAQARKLYKCPACGETLQDTTGNFSAPGFPNGYP
SYSHCVWRISVTPGEKIILNFTSMDLFKSRLCWYDYVEVRDGYWRKAPLLGEFCGDKVPE
PLISTDSRLWVEFRSSSNILGKGFFAVYEAICGGEINKDAGQIQSPNYPDDYRPSKECIW
KITVSEGFHVGLTFQAFEIERHDSCAYDYLEIRDGATEDSVLIGHFCGYEKPDDIKSSSN
KMWMKFVSDGSINKAGFAANFFKEVDECSWPDRNGCEQRCVNTLGSYKCACDPGFELTAD
KKTCEVACGGFMTKLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDV
CKYDYVEIRSGLSSDSKLHGKFCGSEKPEVITSQSNNMRVEFKSDNTVSKRGFKAHFFSD
KDECSKDNGGCQHDCINTFGSYICQCKNGFVLHENGHDCKEAGCEHRLNSAEGTMASPNW
PDKYPSRKECTWNISSTPGHRVKITFNEFEIEQHQECAYDHLEMYDGPNSKSPILGRFCG
SKKPDPVVASTNRMFLRFYSDASVQRKGFQARHSTECGGRLKAEVQTKDLYSHAQFGDNN
YSGHSRCDWVIAAEDGYGVELIFQTFEVEEEADCGYDYMEAFDGYDSTAPRLGRFCGSGP
LEEIYSAGDSLMIRFHTDDTINKKGFHARYTSTKFQDALHMRK
Download sequence
Identical sequences F6UN99
13616.ENSMODP00000005726 ENSMODP00000005726 ENSMODP00000005726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]