SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005751 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005751
Domain Number 1 Region: 1181-1262,1291-1513
Classification Level Classification E-value
Superfamily NHL repeat 8.89e-25
Family NHL repeat 0.0025
Further Details:      
 
Domain Number 2 Region: 1483-1502,1529-1671
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000602
Family SGL-like 0.052
Further Details:      
 
Domain Number 3 Region: 876-947
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000053
Family Pre-dockerin domain 0.069
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000005751
Domain Number - Region: 594-619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00014
Family EGF-type module 0.084
Further Details:      
 
Domain Number - Region: 694-718
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000754
Family EGF-type module 0.048
Further Details:      
 
Domain Number - Region: 627-653
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000828
Family EGF-type module 0.064
Further Details:      
 
Domain Number - Region: 724-749
Classification Level Classification E-value
Superfamily EGF/Laminin 0.001
Family EGF-type module 0.047
Further Details:      
 
Domain Number - Region: 560-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00558
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number - Region: 753-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00754
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005751   Gene: ENSMODG00000004667   Transcript: ENSMODT00000005872
Sequence length 2714
Comment pep:novel chromosome:BROADO5:4:333918258:334574084:1 gene:ENSMODG00000004667 transcript:ENSMODT00000005872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAGSDADAEADAVLSPEHPVRLWGRSTRSGRSSCLSSRANSNLTLTDTEHENTETGRPL
HCSSASSTPIEQSPSPHPSPPANESQRRLLGNGVAQPTQDSDSEEEFVPNSFLVKSGSAN
LCVPANDHPASLQNPSRLRTPPPPLSHAHTPNQHHAASINSLNRGNFTPRSNPSPAPTDH
SLSGEHPVGPPEAAHAQDNWLLNSNIPLETRNIAKQTFLETLQDNLIEMDILTSSRHDGA
YNDGHFLFKPGGTSPLFCTTSPGYPLTSSTVYSPPPRPLPRSTFSRPAFNLKKPYKYCNW
KCAALSAIIISVTLVVLLAYFVAMHLFGLNWHLQPLEGQMYEMTEDTASSWPVPTDVSLY
PSGGTGLELPDRKGKEAGEGKPSSLFPEESFIDSGEIDVGRRASQKIPPGIFWRSQVFID
HPVHLKFNVSLGKAALVGIYGRKGLPPSHTQFDFVELLDGRRLLTQEVRSLEGPQRQSRG
SIPPSSHETGFIQYLDSGIWHLAFYNDGKESEVVSFLTTAIESVDNCPSNCYGNGDCISG
TCHCFLGFLGPDCGRASCPVLCSGNGQYMKGRCLCHSGWKGAECDVPTNQCIDVACSNRG
TCIMGTCICNPGYKGESCEEVDCLDPTCSGRGVCVRGECHCSVGWGGTSCETPRATCLDQ
CSGHGTFLPDTGLCSCDPNWTGHDCSIEICASDCGGHGVCVGGTCRCEDGWMGSACDQRA
CHPRCNEHGTCRDGKCECSPGWNGEHCTIEGCPGLCNGNGRCTLDLNGWHCVCQLGWRGA
GCDTSMETACGDGKDNDGDGLVDCMDPDCCLQPLCHVNALCLGSPDPLDIIQETQAPVSS
QNLRSFYDRIKFLVGKDSTHIVPGENPFDGGHACVIRGQVMTSDGTPLVGVNISFVNNPL
FGYTISRQDGSFDLVTNGGISIILRFERAPFITQEHTLWLPWDRFFVMETIIMRHEENEI
PSCDLSNFARPNPIVSPSPLTAFASSCAEKGPIVPEIQALQEEISISGCSIKLSYLSSRT
PGYKSVLKISLTHPTIPFNLMKVHLMVAVEGRLFRKWFAAAPDLSYYFIWDKTDVYNQKV
FGLSEAFVSVGYEYESCPDLILWEKRTAVLQGYEIDASKLGGWTLDKHHALNIQSGILHK
GNGENQFVSQQPPVIGSIMGNGRRRSISCPSCNGLADGNKLLAPVALACGSDGSLYVGDF
NYIRRIFPSGNVTNILELSHSPAHKYYLATDPITGSVFLSDTNSRRVFKIKSTTIVKDVV
KNSEVVAGTGDQCLPFDDTRCGDGGKATEATLTNPRGITVDKFGLIYFVDGTMIRRIDQN
GIISTLLGSNDLTSTRPLSCDSIMDISQVRLEWPTDLAINPMDNSLYVLDNNVVLQISEN
HQVRIVAGRPMHCQVPGIDHFLLSKVAVHATLESATALAVSHNGVLYIAETDEKKINRIR
QVTTNGEISLVAGAPSGCDCKNDANCDCFSGDDGYAKDAKLNSPSSLAVCADGELYVADL
GNIRIRFIRRNKPFLNTQNLYELSSPIDQELYLFDTSGRHLYTQSLPTGDYLYNFTYTGD
GDITLITDNNGNVLNVRRDSTGMPLWLVVPDGQVYWVTMGTNSALKSVTTQGHELALMTY
HSNSGLLATKSDENGWTTFYEYDSFGRLTNVTFPTGQVSSFRSDTDSSVHVQVETSSKDD
VTITTNLSASGAFYTLLQDQVRNSYYLGADGSLRLILANGMEVALQTEPHLLAGTVNPTV
GKRNVTLPIDNGLNLVEWRQRKEQARGQVTVFGRRLRVHNRNLLSLDFDRVTRTEKIYDD
HRKFTLRILYDQAGRPSLWSPSSRLNGVNVTYSPGGHIAGIQRGTMSERMEYDQAGRITS
RIFADGKSWSYTYLEKSMVLLLHSQRQYIFEFDKNDRLSSVTMPNVARQTLETIRSVGYY
RNIYRPPEGNASVIQDFTEDGRLLHTLYLGTGRRVIYKYGKLSKLAEMLYDTTRIGFTYD
ETAGMLKTINLQNEGFTCTIRYRQIGPLIDRQIFRFTEEGMVNARFDYNYDNSFRVTSMQ
AVINETPLPIDLYRYDDVSGKTEQFGKFGVIYYDINQIITTAVMTHTKHFDAYGRMKEVQ
YEIFRSLMYWMTVQYDNMGRVVKKELKVGPYANTTRYSYEYDADGQLQTVSINDKPLWRY
SYDLNGNLHLLSPGNSARLTPLRYDLRDRITRLGDVQYKTDEDGFLRQRGGDVFEYNAAG
LLVKAYNRAGGWSVSYRYDGLGRRVSSRTSHGHHLQFFYADLTSPTKVTHLYNHSSSEIA
SLYYDLQGHLFAMELSSGDEFYIACDNIGTPLAVFSGTGLMIKQISYTAYGEIYMDTNPG
FQIIIGYHGGLYDPLTKLIHMGRRDYDVLAGRWTSPDHDVWKRLKSSAVVPFNLYMFKNN
NPISHSQDIKCYMTDVNSWLLTFGFQLHNVIPGYPKPDTDAMEPSYELVQTQMKTQEWDN
SKSILGVQCEVQRQLKSFVTLERFEQIYGSNVVGCQQTQETKKFASSGSIFGKGVKFAMK
DGRVATDIISTANEDGRRIAAILNNAHYLENLHFTIEGVDTHYFVKPGPSESDLAILGLN
GGRRTLENGVNVTVSQINTMLNGRTRRYTDIQLQHGALCLNTRYGTTLDEEKARVLELAR
QRAVGQAWVQEQQRLREGEEGIRSWTEGEKQQMLSTGRVQGYDGYFVISVEQYPELADSA
SNIHFMRQSEMGRR
Download sequence
Identical sequences F6U762
ENSMODP00000005751 ENSMODP00000005751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]