SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005835 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005835
Domain Number 1 Region: 7-43
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000718
Family BAFF receptor-like 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005835   Gene: ENSMODG00000004737   Transcript: ENSMODT00000005958
Sequence length 184
Comment pep:novel chromosome:BROADO5:6:105200851:105203862:1 gene:ENSMODG00000004737 transcript:ENSMODT00000005958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTTQRCFQNEYLDNLLHACKPCHLRCSNTPPLVCQSYCNASTTSSLKIIDVNLWIYLSV
GIISSLTVFLLILMLKKRSPERSKEELKNTETKAELKEIIKVDLDRNENDEAGIFPRNST
TMTYMVEECKYKDCGEGDDISFPFPTMEEGATVFVDTKTNDFCKSSPSSMNDTFMGLWKS
VFTT
Download sequence
Identical sequences F6Y173
ENSMODP00000005835 ENSMODP00000005835 XP_007498679.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]