SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005865 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005865
Domain Number 1 Region: 7-131
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 1.05e-22
Family CSE2-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005865   Gene: ENSMODG00000004759   Transcript: ENSMODT00000005988
Sequence length 135
Comment pep:novel chromosome:BROADO5:6:73151203:73174171:1 gene:ENSMODG00000004759 transcript:ENSMODT00000005988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSGRPAEETLPQPPEPPLPEQKPLPAPQPQPQPQQQPPQPQPPGGLKEEETYSFLPLVHD
VIKCMDKDSVDMHQELTALKTKFQEMRKVISTMPGIGSSPEQQQQQLQSLREQVRTKNEL
LQKYKSLCMFEIPKE
Download sequence
Identical sequences F6X175
ENSMODP00000005865 ENSMODP00000005865 13616.ENSMODP00000005865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]