SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005942 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005942
Domain Number 1 Region: 428-570
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 1.57e-50
Family Lamin A/C globular tail domain 0.00000941
Further Details:      
 
Domain Number 2 Region: 304-381
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 3.84e-19
Family Intermediate filament protein, coiled coil region 0.00012
Further Details:      
 
Domain Number 3 Region: 29-62
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000204
Family Intermediate filament protein, coiled coil region 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000005942
Domain Number - Region: 113-213
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00259
Family Myosin rod fragments 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005942   Gene: ENSMODG00000004824   Transcript: ENSMODT00000006066
Sequence length 608
Comment pep:novel chromosome:BROADO5:3:455367911:455400899:-1 gene:ENSMODG00000004824 transcript:ENSMODT00000006066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPMSSRSAASGLGPGTPLSPARISRLQEKEELRELNDRLAHYIDRVRALELENDRLLL
QVSEKEEVTTREVSGIKVLYESELADARRVLDETARERAKLQIEIGKLRAELDEVNKNCK
KKDGDLTVAQGRVKDLESLFHRSEAELSAALSDKRNLENDVAELRAQLAKAEDGHAVAKK
QLEKETLMRVDLENRYQSLQEELDFRKNIFEEEVRETRKSHERRLVEVDSSRQQEYEFKM
AQALEDLRNQHDEQVRLYKLELEQTYQAKLENAKLCSDQNDKAANAAREELKEARMRVES
LSYQLSSLQKQASAAEDRIRELEEILGGEREKFRKMLDAKEREMTEMRDQMQQQLTEYQE
LLDVKLALDMEINAYRKLLEGEEERLKLSPSPSSRVTVSRATSSSSSSSTSAIRSSRSKR
KRVELEEHSGSGTSSGIGTGSSASSASSSSFQLSQQASATGNISIEEIDLEGKFVQLKNS
SDKDQSLGNWRLKRQIGDGEEIAYKFTPKYVLRAGQTVTIWAADAGVTHSPPSVLVWKNQ
SSWGTGGNFRTYLVNADGEEVAVRTVTQSLVVQENGEEEEEEEADFGEEDLFHQQGDPRT
TSRGCSVM
Download sequence
Identical sequences F6UM44
ENSMODP00000005942 XP_001372674.1.35504 ENSMODP00000005942 13616.ENSMODP00000005942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]