SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000005945 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000005945
Domain Number 1 Region: 1-287
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.02e-79
Family FCH domain 0.0000000093
Further Details:      
 
Domain Number 2 Region: 522-595
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-17
Family SH3-domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000005945
Domain Number - Region: 400-467
Classification Level Classification E-value
Superfamily HR1 repeat 0.0196
Family HR1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000005945   Gene: ENSMODG00000004822   Transcript: ENSMODT00000006069
Sequence length 620
Comment pep:novel chromosome:BROADO5:2:458063851:458177546:1 gene:ENSMODG00000004822 transcript:ENSMODT00000006069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWGTELWDQFDNLDKHTQWGIDFLERYAKFVKERIEIEQNYAKQLRNLVKKYCPKRSSK
DEEPRFTSCIAFFNILNELNDYAGQREVVAEEMGHRVYGELMRYSHDLKTERKMHLQEGR
KAQQYLDMCWKQMDNSKKKFERECREAEKAQQSYERLDNDTNATKADVEKAKQQLNLRTH
MADENKNEYAAQLQNFNGEQHKHFYIVIPQIYKHLQEMDERRTIKLSECYRGFADSERKV
VPIISKCLEGMIHAAKSVDERRDSQMVVDSFKSGFEPPGDFPFEDYSQHIYRTVSDGTIS
ASKQDSGKIDAKTTVGKAKGKLWLFGKKPKPQSPPLTPTSLFTSSTPNGSQFLTFSIEPV
HYCMSEIKTGKPRIPSFRSLKRGWSVKMGPALEDFSHLPPEQRRKKLQQRIDELNRELQK
ESDQKDALNKMKDVYEKNPQMGDPCSLQPKLAETMNNIDRLRMEIHKNEAWLSEVEGKTG
GRGDRRHSSDINHLVTQGRESPEGSYTDDANQEVRGPPQQHNHPNEFDDEFEDDDPLPAI
GHCKAIYPFDGHNEGTLAMKEGEVLYIIEEDKGDGWTRARRQNGEEGYVPTSYIDVTLEK
NSKDYDLSVLEDGINPEIML
Download sequence
Identical sequences F6ULY9
ENSMODP00000005945 ENSMODP00000005945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]