SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006004 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006004
Domain Number 1 Region: 306-475
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-51
Family SPRY domain 0.0000288
Further Details:      
 
Domain Number 2 Region: 22-99
Classification Level Classification E-value
Superfamily RING/U-box 8.73e-21
Family RING finger domain, C3HC4 0.009
Further Details:      
 
Domain Number 3 Region: 112-175
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000473
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006004
Domain Number - Region: 233-287
Classification Level Classification E-value
Superfamily G protein-binding domain 0.0837
Family Rabaptin-5 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006004   Gene: ENSMODG00000004876   Transcript: ENSMODT00000006132
Sequence length 476
Comment pep:novel chromosome:BROADO5:7:84044936:84046941:-1 gene:ENSMODG00000004876 transcript:ENSMODT00000006132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VELPLNPLRELSPQRRKGRNQKPRNMDTRDLIENLKADLTCSICLGYFTDPVIVKCGHNF
CRVCLLRCREEADAAFKCPECRGVIEDRDVVPNRKLENLSMTGKRLRPHLLESMVDLYVC
DQHGEKEKLFCEEDQRLLCASCVLAPGHKDHTVLPLEMAAHKCEDKIKHTLNTLQRKKEE
FNAALDRVRRIGNLCGNGIHSFKESVTLEYRKLREFLCEEEELYLQSLDQKHTDNVAKLE
HNTAKLSQQIQNLEKMKIELEENLDKEPLEMLQDMKDTLARNEELLLQEPEVVSFAWNTS
PITGLTKMLKRFQRDISFDPKSANPHLILSEDMRGVKYEDVPQDLPDNKERFDVALTVLG
AQTFTSGKHYWEIKVADQFEMGVCKDSIRRKGKLSPLSEDVWILISFRLCNDCFLWNSRD
GFFMSQPLEKVGIFLDYDKRHVAFYDAIDGSLICSFSDMAFEGPLRPYFSFCSGKG
Download sequence
Identical sequences F7CKM6
ENSMODP00000006004 13616.ENSMODP00000006004 ENSMODP00000006004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]