SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006015 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006015
Domain Number 1 Region: 2-185
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-60
Family SPRY domain 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006015   Gene: ENSMODG00000004886   Transcript: ENSMODT00000006143
Sequence length 186
Comment pep:novel chromosome:BROADO5:7:84100385:84100942:1 gene:ENSMODG00000004886 transcript:ENSMODT00000006143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LREMLMNFHRDITLDPDSANPHLILSEDLKSVKYGNVPQDLPDNRERFDYALIVLGTQTF
SSGKHYWEVKVGEKTEWEVGISKESIRRKGKLSSLSQDVWILVSFKSGNDWFLGNSRDGL
HLSQPIDKVGIFLDYDKGHIAFYDVIDKSLISSLSHTAFEGPLRPYFSPCRPNEESSPGS
LIICHK
Download sequence
Identical sequences F7C2M1
ENSMODP00000006015 ENSMODP00000006015 13616.ENSMODP00000006015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]