SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006026 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006026
Domain Number 1 Region: 280-451
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-57
Family SPRY domain 0.0000166
Further Details:      
 
Domain Number 2 Region: 8-75
Classification Level Classification E-value
Superfamily RING/U-box 1.87e-19
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 87-149
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000275
Family B-box zinc-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006026   Gene: ENSMODG00000004893   Transcript: ENSMODT00000006154
Sequence length 464
Comment pep:novel chromosome:BROADO5:7:84162337:84163728:1 gene:ENSMODG00000004893 transcript:ENSMODT00000006154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDARNLIENLKADLTCSICLGYFTDPVIVKCGHNFCRVCLLRCREEADAAFKCPECRGVI
EDSDVVPNRKLENLSMTGKRLRPHLLQSITLALCDQHGEKEKFFCEEDQKLLCASCVLAP
GHKDHTVLPLEMAAGKWEDKIKHTLNTLQRKKEEFNVALDRVTKRRRLCKKAIRSLKESV
ISEYRKLHDFLWEEEELYLETLDQQYKNNLEKLEHNTAKLSQQIQNLERMKIELEENLDK
EPLEMLQDMKDTLARNEELLLQEPEVASLAWNTSPITGLTKMLKRFQSDISLDPESSNPH
LILSEDLKSFKYGDVPQDLPDNKERFDNALAVLGAQTFTSGKHYWEVKVGDKTEWGVGVC
KDSVRRKGQLSSSENVWILVSLRSGYLCVLCNSNYGTHWNYPIDQIGIFLDYDKRHIAFY
DAMNGYLISSFSDMDFEGPLRPYFSLCCPNGESTPGSIMLINMG
Download sequence
Identical sequences F7C2D8
13616.ENSMODP00000006026 ENSMODP00000006026 ENSMODP00000006026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]