SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006044 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006044
Domain Number 1 Region: 437-566
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000204
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 628-670
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000958
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 3 Region: 730-856
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000863
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 4 Region: 662-703
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000336
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 5 Region: 339-453
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000596
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number 6 Region: 296-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000107
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 707-740
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000002
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 8 Region: 852-911
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000126
Family VWC domain 0.032
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006044
Domain Number - Region: 591-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000324
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 262-299
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0508
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006044   Gene: ENSMODG00000004910   Transcript: ENSMODT00000006172
Sequence length 1217
Comment pep:novel chromosome:BROADO5:1:614424011:614461225:1 gene:ENSMODG00000004910 transcript:ENSMODT00000006172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPRAAVRTECSLSLIIALLCLRVKVSSASGQFELEILSMQNLNGELQNGNCCDGSRNP
EDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKLNRNSERYRIV
LPFSFAWPRSYTLLVEAWDYSNDTNNPDSIIEKASHSGMINPSRQWQTLKQNTGMAHFEY
QIRVTCDEHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPK
HGSCKIPGECRCQYGWQGQYCDKCIPHPGCVHGTCIEPWQCLCETNWGGQLCDKDLNYCG
THQPCLNGGTCSNTGPDKYQCSCPEGYSGANCEIAEHACLSDPCHNGGSCLETSMGFECR
CLPGWTGPTCTTNIDDCSPNHCGHGGTCQDLVNGFKCICPPQWTGKTCQIDANECEAKPC
VNANSCRNLIGSYYCDCIPGWTGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYAG
DHCEKDINECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQCY
NRASDYFCKCPEDYEGKNCSHLKDHCRTSPCEVIDSCTVAMASNDTPEGVRYISSNVCGP
HGKCRSQAGGKFTCECNKGFTGTYCHENINDCESNPCKNGGTCIDGVNSYKCICGDGWEG
TYCETNINDCSKNPCHNGGTCRDLVNDFYCECKNGWKGKTCHSRDSQCDEATCNNGGTCY
DEVESFKCLCPAGWEGATCNIARNSSCLPSPCHNGGTCVVNGDSFTCVCKEGWEGPICTQ
NTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEING
YRCLCPPGHSGPKCQEVTGRPCITTGRVMPDGAKWDDDCNACQCLNGKVACSKVWCGPRP
CLIHGQGASECPAGQSCIPIQEDQCFVRPCTGVGECRSSNPQPVKTKCTSDSYYQDNCAN
ITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAED
TREDGNPIKEITDKIIDLVSKRDGNSTLIAAIAEVRVQRRPNKKQDFLVPLLSSVLTVAW
ICCLVTAFYWCIRKRRKPSSHTHTASDDNTTNNVREQLNQIKNPIEKHGANTVPIKDYEN
KNSKIAKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDRDEKPPNSTPTKHPNWTNKQD
NRDLESAQSLNRMEYIV
Download sequence
Identical sequences F7C1Q4
13616.ENSMODP00000006044 ENSMODP00000006044 XP_001382123.1.35504 XP_016283254.1.35504 ENSMODP00000006044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]