SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006121 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006121
Domain Number 1 Region: 388-629
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.43e-86
Family Eukaryotic proteases 0.00000166
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006121
Domain Number - Region: 113-158
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00126
Family Hairpin loop containing domain 0.054
Further Details:      
 
Domain Number - Region: 306-347
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0108
Family Pan module (APPLE domain) 0.024
Further Details:      
 
Domain Number - Region: 221-245
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0412
Family Pan module (APPLE domain) 0.062
Further Details:      
 
Domain Number - Region: 42-63
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0844
Family Pan module (APPLE domain) 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006121   Gene: ENSMODG00000004972   Transcript: ENSMODT00000006250
Sequence length 630
Comment pep:novel chromosome:BROADO5:5:78612720:78642441:-1 gene:ENSMODG00000004972 transcript:ENSMODT00000006250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFPCQAVFFLFFFATVTSECVTQLYENTFFKGGDVGAVYTPTAKHCQKVCTFHPRCILF
SFLPANSIDDEKKRFGCFLKDSITGTLPRVTRRNAFSGHSLKLCSNRPSICNKEKYEGLD
MRGENFNITKVNTVEECEKQCTNHVLCHFYTYATQTFYNPQFRNTCLLKHSPSGTPSAIK
MADGLVSGFSLKPCGLSNMGCSTTIFQHLSFSGENVGSVIAPDRSVCRTICTYHPNCLFF
TFYTSNWHIESQRNMCFLMTSNSGKPSSKIPQDNAESGYSLLNCEDVTGLKSLTSRVQCH
WNFYHGMDFEGDKLEDVYVHGPEACQQSCTNTIRCQFFTYTSLRGECKEDKCKCSLKISS
DGAPTRIIHGTEGISGYTLRLCKTPSISVCPTFTGRIVGGKPSSLKEWPWQVSLQVKLRT
QSHVCGGSIIGDQWVLTAAHCFDGLSSPDIWRIYSGILNQSEIQADTPFSRAKEIIIHHQ
YEISEIGHDIAIIKLDTPLNCTDSQSSICLPSEENTYQDCWVTGWGYTQEKGEIQNTLLK
ANIPLISNEECQKKYLQYKVTDHMICADDKEGGKDSCKGDSGGPLSCIHNGKWKLVGITS
WGDGCGQKDHPGVYTKVTAYLDWILENTRN
Download sequence
Identical sequences F7FL16
ENSMODP00000006121 XP_007496092.2.35504 XP_007496093.1.35504 ENSMODP00000006121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]