SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006135 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006135
Domain Number 1 Region: 336-454
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000506
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006135
Domain Number - Region: 49-92
Classification Level Classification E-value
Superfamily HR1 repeat 0.0034
Family HR1 repeat 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006135   Gene: ENSMODG00000004982   Transcript: ENSMODT00000006264
Sequence length 586
Comment pep:novel chromosome:BROADO5:5:237756688:237771147:1 gene:ENSMODG00000004982 transcript:ENSMODT00000006264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGLGLVSCLERKGPREGSMCRGGKRAECRPCPPSPLSLLEDWGGEGDTELQRKLDHEIRM
REGACKLLAACSQREQALEATKSLLVCSSRILSYMGELQRRKEAQVLGRTARRPSETGPP
DERSPCRGTVCISDIRIPLMWKDTEYFKNKGDLHRWAVFLLLQLGGNIQDTEMVLVDRTL
TDISFQSSLLFIEAGPDFELRLELYGACVEEEGALTGAPRRLASKLSNSLGRSSGRRVRA
SLESAGGSGSSSAGNPILLPTPAVGGPRYHLLAQTTLTLAAVQDGFRTHDLTLTSNEENP
AWLPLYGSVCCRLAAQPLCMTQPVMKGEGRRSQVGGQQSWGQVHGILKGTNLFCYRHPGE
ANTQEDPLFTIAINKETRVRAGERDQSLGGPPTLSISNRYGGDEVTHTLQMESRGALQRW
MEALWQLFFDMSQWKQCCDELMKIEVPSPRKPPPALAKQGSLYHEMAIDPLDDIAAVTDI
AKQEGLPLDVPPPWLALFTEKLPSSKRPIHAPRSPSPPRACPGSRATPWGRPRTLSLDAA
PRGRPPLPPRSSSSSSSGSGSPAPRQRSPPARGFRAKARPWLQSPV
Download sequence
Identical sequences F7FKQ6
ENSMODP00000006135 13616.ENSMODP00000006135 ENSMODP00000006135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]