SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006143 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006143
Domain Number 1 Region: 381-613
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.55e-82
Family Eukaryotic proteases 0.00000101
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006143
Domain Number - Region: 131-172
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00122
Family Pan module (APPLE domain) 0.043
Further Details:      
 
Domain Number - Region: 29-91
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00392
Family Pan module (APPLE domain) 0.039
Further Details:      
 
Domain Number - Region: 304-352
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0051
Family Pan module (APPLE domain) 0.02
Further Details:      
 
Domain Number - Region: 224-246
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0141
Family Pan module (APPLE domain) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006143   Gene: ENSMODG00000004989   Transcript: ENSMODT00000006273
Sequence length 618
Comment pep:novel chromosome:BROADO5:5:78560404:78609515:-1 gene:ENSMODG00000004989 transcript:ENSMODT00000006273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIQLYQMILFTVSFVLVSGECMIELYKDIYFQGGDVATVFTPNAKYCQIVCTYHPRCLLF
SFLLARSTKDTSKWFACFLKDSVTETLPTVNMTGAISGHSFKQCQHQLSACHTDIYRGLD
MKGMNYKSSITTSVQECEDRCTNDAHCHFFTYATQMFHSETHRNVCLLKYSTTGFPTKIE
MLENVISGFSLKSCAVSKMACIRDIFPNTVFADINEDSFFTPDPWVCQRICTHHPKCLFF
TFLSKEWSTESQRNLCLLKTSQSGIPSTRITRKNASSGFSLLSCRHSVPVFCHASIYYNT
DFLGEELDIFEVKDHSACQESCTNTIRCQFFTYSPPGETCNKEKGKCYLKMSSNGSPSKI
IHGKGGISGYTLRLCKMENACTNKIKGKIVGGTKSVLAEWPWQVSLHITSPIQKHLCGGS
IIGKQWILTAAHCLEELEAATDLHVYAGIVNQSEIHENTPFFRVQKIIIHDKYEMAEYGY
DIALLKVEAPINYTVLQQPICLPSKEDGKTIYADCWVTGWGYTKERGKVQDTLQKASIPL
ITNEDCQMRYREHKITSQMICAGYKEGGKDACKGDSGGPLSCKHNGIWQLVGITSWGEGC
ARPGRAGVYTKVAESFHR
Download sequence
Identical sequences F7FKH6
ENSMODP00000006143 ENSMODP00000006143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]