SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006169 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006169
Domain Number 1 Region: 910-978
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.57e-19
Family TB module/8-cys domain 0.00076
Further Details:      
 
Domain Number 2 Region: 2014-2085
Classification Level Classification E-value
Superfamily TB module/8-cys domain 9.29e-19
Family TB module/8-cys domain 0.0000985
Further Details:      
 
Domain Number 3 Region: 674-813
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.91e-18
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 2333-2467
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.24e-17
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 2274-2346
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.54e-17
Family TB module/8-cys domain 0.00052
Further Details:      
 
Domain Number 6 Region: 987-1117
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.85e-17
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 7 Region: 409-539
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.57e-17
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 8 Region: 1813-1937
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.21e-16
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 9 Region: 1486-1559
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.57e-16
Family TB module/8-cys domain 0.0000603
Further Details:      
 
Domain Number 10 Region: 615-688
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.49e-16
Family TB module/8-cys domain 0.00071
Further Details:      
 
Domain Number 11 Region: 284-353
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.53e-16
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 12 Region: 179-264
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.19e-16
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 13 Region: 1646-1712
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.59e-16
Family TB module/8-cys domain 0.00053
Further Details:      
 
Domain Number 14 Region: 807-891
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000693
Family TB module/8-cys domain 0.0016
Further Details:      
 
Domain Number 15 Region: 1115-1253
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000118
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 16 Region: 1366-1496
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000022
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 17 Region: 1938-2019,2091-2134
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000502
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 18 Region: 1240-1370
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000022
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 19 Region: 1565-1620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000291
Family EGF-type module 0.00051
Further Details:      
 
Domain Number 20 Region: 528-577
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000571
Family EGF-type module 0.013
Further Details:      
 
Domain Number 21 Region: 568-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000617
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 22 Region: 2232-2276
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000179
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 23 Region: 1770-1808
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000019
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 24 Region: 2552-2599
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000026
Family EGF-type module 0.006
Further Details:      
 
Domain Number 25 Region: 2591-2630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000239
Family EGF-type module 0.0096
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006169
Domain Number - Region: 150-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00464
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006169   Gene: ENSMODG00000005011   Transcript: ENSMODT00000006299
Sequence length 2798
Comment pep:novel chromosome:BROADO5:3:461500422:461608998:1 gene:ENSMODG00000005011 transcript:ENSMODT00000006299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTMTSTWMTQILLGWTTLVCLVQAQWEGAIRTDRPTGSEETPALSRVRRRGFDTLRGPNV
CGSRFHSYCCPGWRTLPGGNQCIVPICRNSCGEGFCSRPNLCACANGQLSPSCGASGEIC
GCLLWGGGFLGNVGCQLGDNLSLCFSPAVCDQSCQNGGRCIGPNRCACVYGFTGPQCERD
YRTGPCFSQVNNQVCQGQLSGLVCTKTMCCASVGRAWGHPCEPCPAQPHPCRRGFIPNIR
TGACQDVDECRAIPGLCQGGNCINTVGSFECRCPAGHRLGEASHKCEDQRVGTCFSALLG
GRCAGELPGQASKRQCCCEWGRCWAMGSTPEMCPQRGSDEFRQLCAEGPPVLPAYPGHFP
GLPGFGPNGLGPGLTGPARHGPHGTNGQGALPSLPGLGPGSSSIGTATLNQTIDICKHFT
NLCLNGRCLPTSSSYRCECNMGYKQDVRGECIDVDECSSSPCVHGDCVNTPGSYHCKCQE
GFQSTPTKQSCVDIDECILNGGMCRHGRCINTEGSFQCICNAGFEITPDGKNCVDHDECA
TTTMCLNGVCLNEAGSFKCLCKPGFLLAPSGRYCVDIDECETPGICMNGWCINTEGSFRC
ECVGGLAIGADGRVCVDTHMRSTCYGAIKKGTCARPFPGAVTKSECCCTSPDHGFGEPCQ
PCPAKNSDEFQALCSSGLGITADGRDINECALNPDICPNGVCENLRGSYRCICHLGYEAD
PPGKECVDVDECALNRLLCDNGLCRNTPGSYTCTCPTGFTFKTETDSCEDIDECLSNPCV
NGLCRNHAGSFACECSPGSRLDPAGNVCVDSMKGTCWLQIQDGRCEANINGATLRSECCA
TLGAAWGSPCQLCETDPACSRGFARMKGLTCEDVNECEVFPSVCPNGRCLNTAGSFRCEC
PEGLTLDSTGRVCVDVRVEQCFLKWDEDECLAPLSGKYRMDMCCCSVGAAWGADCEACPE
PGSPEFAIICPRGPGFASRDFLSGRPFYKDVNECKAFPGLCTHGSCRNTVGSFRCMCGNG
FALDAQERNCTDIDECRISPDLCGHGTCVNTLGSFECECFQGYESGFMMMKNCMDIDECA
QDPLLCRGGTCINSDGSYQCLCPPGHELSADGNACGDVNECSLRDNLCRHGRCVNVIGTY
QCACDTGFQSTPDRQGCIDTDECSVGNGGCETHCTNTEGSYQCSCGEGYALMPDGRACAD
IDECEENPDICDGGQCTNVPGQHRCLCYDGFMATLDMKTCIDVNECDLNPNICLHGDCEN
SKGSFICHCQLGYFVKKGTTGCTDIDECALGAHNCDARASCVNVPGTFRCMCQSGWVGDG
FKCHDLDECATEDHGCHINADCVNSPGSHRCVCREGFSGDGFSCVDRDECADNVNLCENG
QCLNAPGGYRCECEMGFNPTEDSRACQDIDECTFQNICVFGSCHNLPGMFRCVCDDGYEL
DRSGGNCTDINECADPVNCINGLCVNTPGSYLCNCPQDFELNPSGVGCVDTRVGNCFLDT
QDRGDGGISCSAEIGVGVTRASCCCSLGRAWGNPCELCPPGNTTEYKTLCPGGEGFRPNP
ITVILEDIDECQELPGLCQGGDCVNTFGNFQCECPLNYYLNEDTRICEDIDECSTHVGIC
GPGTCYNTLGNYTCVCPPEYMQVNGGNNCMDVRKSVCYRHHNDTCENELAFNMTRKMCCC
SYNIGKAWNRPCEPCPAPASSEYQILCGNQAPGFIIDIHTGKPIDIDECSEIPAIYYLPH
LQRIAPPHQLSSQGSYPCSPPLFHIPDVIKDMDECSSGESPCQRHADCINIPGSYRCECA
RGYKLSPSGACVGRNECQEIANVCSHGDCVDTEGSYACICHQGFKATADQTMCMDIDECD
RQPCGNGTCKNTVGSYNCLCFPGFELTHNSDCMDIDECTSLTGQVCRNGQCINSIGSFQC
LCHEGYERTADGKNCVDINECVSFPGTCSPGTCQNLDGAFRCICPPGYQVQDDSCIDINE
CDEEPNLCLFGTCTNSPGSFQCLCPPGFVLSDNGRRCFDTRQSFCFTRFENGRCSVPKAF
NTTKARCCCSKMPGEGWGDPCELCPQEGSGAFQELCPFGHGAVPGPDDSREDVNECSENP
GICVNGVCINTDGSFRCECPFGYSLDYTGVNCVEFHFFSFEFICFSLLCFPIIMLQCCSL
TLFLYLCLIPVPLTFSRHLPTLAKVWHPCLGSWEGAIPYPSPQCLRTFFCIPHPSTQQLP
SLGDAGLMSFSPSDENECRTQPGLCSNGRCVNTVGSYHCDCNEGFQASPTGTECLDTRQG
SCFTEVLQTTCQLSSSNHNPVTKAECCCDGGRGWGSLCEICPLPGTAQHKKMCPHGSGYT
TDGRDIDECKVLSNLCQNGQCINTIGSFRCHCETGYTPDITGTACVDVDECEQSPKPCNF
LCKNTEGSFKCSCPRGYLLQGNGKTCKDLDECATKQHNCQFLCVNTVGGFTCKCPPGFTQ
HHHSCLASSPLSPGPLECSAGAQSHNRVSPGSLSTIGLPLSPDAFPLAPSSHTLPSCWTD
FLAQNFLQFTCPSPSLGPGTGLHPKLCLLLPDDNECSSPTACGSASCYNTLGSFKCVCPS
GYDFDQAFGGCRDVDECSAGGSPCSYGCSNTNGGYLCGCPGGYFRAGQGHCISGLGFDKN
SYLPTLSEEEDEENLLSPDTCYECKINGYSQRSRQRRHINGTQRHQMSLASVDTEAPLAM
ALNLSNLGPREHILELLPAVEALENRVLYIIAHGNEAGFFRMQHKEGLSYLRLGRKKPGP
GAYQLEVMSVPRPAGDELGEPAGQGGHALRLKLQLQLY
Download sequence
Identical sequences F7ERX4
13616.ENSMODP00000006169 ENSMODP00000006169 ENSMODP00000006169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]