SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006174 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006174
Domain Number 1 Region: 3765-3960
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-38
Family Laminin G-like module 0.0041
Further Details:      
 
Domain Number 2 Region: 3278-3389
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-32
Family Cadherin 0.00053
Further Details:      
 
Domain Number 3 Region: 1079-1207
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-30
Family Cadherin 0.0016
Further Details:      
 
Domain Number 4 Region: 777-913
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-30
Family Cadherin 0.00088
Further Details:      
 
Domain Number 5 Region: 3172-3276
Classification Level Classification E-value
Superfamily Cadherin-like 6.02e-30
Family Cadherin 0.002
Further Details:      
 
Domain Number 6 Region: 2224-2331
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-29
Family Cadherin 0.001
Further Details:      
 
Domain Number 7 Region: 3068-3171
Classification Level Classification E-value
Superfamily Cadherin-like 6e-29
Family Cadherin 0.00052
Further Details:      
 
Domain Number 8 Region: 1504-1605
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-28
Family Cadherin 0.00097
Further Details:      
 
Domain Number 9 Region: 2751-2860
Classification Level Classification E-value
Superfamily Cadherin-like 2.88e-28
Family Cadherin 0.0015
Further Details:      
 
Domain Number 10 Region: 972-1090
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-28
Family Cadherin 0.0006
Further Details:      
 
Domain Number 11 Region: 2966-3074
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-26
Family Cadherin 0.00071
Further Details:      
 
Domain Number 12 Region: 1707-1827
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-25
Family Cadherin 0.0011
Further Details:      
 
Domain Number 13 Region: 104-226
Classification Level Classification E-value
Superfamily Cadherin-like 8.14e-25
Family Cadherin 0.0012
Further Details:      
 
Domain Number 14 Region: 676-781
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-24
Family Cadherin 0.0013
Further Details:      
 
Domain Number 15 Region: 2860-2964
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-23
Family Cadherin 0.00079
Further Details:      
 
Domain Number 16 Region: 1393-1502
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-23
Family Cadherin 0.0015
Further Details:      
 
Domain Number 17 Region: 424-525
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-22
Family Cadherin 0.00082
Further Details:      
 
Domain Number 18 Region: 2017-2124
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-22
Family Cadherin 0.0024
Further Details:      
 
Domain Number 19 Region: 3382-3486
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-22
Family Cadherin 0.0014
Further Details:      
 
Domain Number 20 Region: 2124-2231
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-21
Family Cadherin 0.0014
Further Details:      
 
Domain Number 21 Region: 1609-1730
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-21
Family Cadherin 0.002
Further Details:      
 
Domain Number 22 Region: 2533-2644
Classification Level Classification E-value
Superfamily Cadherin-like 8.14e-21
Family Cadherin 0.0012
Further Details:      
 
Domain Number 23 Region: 2435-2545
Classification Level Classification E-value
Superfamily Cadherin-like 5e-20
Family Cadherin 0.0022
Further Details:      
 
Domain Number 24 Region: 1815-1940
Classification Level Classification E-value
Superfamily Cadherin-like 8.9e-20
Family Cadherin 0.0038
Further Details:      
 
Domain Number 25 Region: 2332-2431
Classification Level Classification E-value
Superfamily Cadherin-like 1.13e-19
Family Cadherin 0.0032
Further Details:      
 
Domain Number 26 Region: 1191-1303
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-17
Family Cadherin 0.0024
Further Details:      
 
Domain Number 27 Region: 1923-2029
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-16
Family Cadherin 0.002
Further Details:      
 
Domain Number 28 Region: 529-630
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000131
Family Cadherin 0.0033
Further Details:      
 
Domain Number 29 Region: 2649-2758
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000443
Family Cadherin 0.0062
Further Details:      
 
Domain Number 30 Region: 4041-4080
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000126
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 31 Region: 333-420
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000414
Family Cadherin 0.0047
Further Details:      
 
Domain Number 32 Region: 3491-3580
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000171
Family Cadherin 0.0099
Further Details:      
 
Domain Number 33 Region: 1-116
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000002
Family Cadherin 0.0065
Further Details:      
 
Domain Number 34 Region: 4004-4046
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family EGF-type module 0.007
Further Details:      
 
Domain Number 35 Region: 218-319
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000428
Family Cadherin 0.0053
Further Details:      
 
Domain Number 36 Region: 3963-4004
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000101
Family EGF-type module 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006174
Domain Number - Region: 3743-3774
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0345
Family EGF-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006174   Gene: ENSMODG00000005018   Transcript: ENSMODT00000006304
Sequence length 4497
Comment pep:novel chromosome:BROADO5:5:78109677:78252929:1 gene:ENSMODG00000005018 transcript:ENSMODT00000006304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTHFQYNVTVYENSAAKTYVGHPVKMGIYLTDPSWEIRYKIISGDNENLFKAEEYILGDF
CFLRIRTKGGNTAILNREVKDHYLLTVKAVEKNTNAEARTKIRVQVLDTNDLRPLFSPTS
YSVSLPENTIIRTSIARVSATDADIGTNGEFYYSFKERTDMFAIHPTSGVVVLTGRLDYA
ETKLYEMEILAVDRGMKLYGSSGISSMARLTVHVEQANEFAPVITAVTVSPSELEKDPTY
AIVTVEDHDQGSNGEIASLSIVAGDPLQQFRTVRSFPGSKEYKIKTVGHVDWESHPFGYN
LTLQAKDKGNPPQFSSVKVIHVTSPRFKEGPVRFEKDIYRAEISEFAPPHTPVVMVKAIP
YYSHLKYVFKNTPGKGRFHINPNTGLITILEPIRTQQASHLEFDVTTSDRKASTKVLVKV
LGANSNPPEFTQTSYRASFDENVPIGTSIMSVSAIDPDEGENGYVTYSIANLNHVPFVIN
HFTGAVSTSEHLDYELMPRVYTLRIRASDWGLPYRREVEALVTLTLNNLNDNTPLFEKIN
CEGTIPRDLGVGEQITTVSAIDADELQLVRYQIEAGNELDLFSLNPSSGVLSLKHSLVEG
LGAKVSFHSLRITATDGENFATPLYINITVAASRKPVNLHCEETGVAKMLAEKLLQANKL
HNRGEVEDVFFDTHSINAHAPQFRSSLPTSIEVKENYPVGSNIILVNATDLDSGFNSKLV
YAISGGNDDSCFMIDLETGMLKVLSPLDREATEKYTLNITVYDLGIPQKASWRLLDIRVL
DANDNKPEFLQESYFIEVSEDREPYSEIIQVEAVDKDLGPNGEVKYYLLTDTDKFSIDSE
TGIVKVVGPLDREMQHVHFLKIEARDQAETEPQLFSTVLLKVSLEDVNDNPPKFIPSNYL
VKVREDLPEGTVIMWLEAYDPIWSVPVSEVQPHRQRDETRRRQLKEQVTNLTSGAKTKGK
HISLSSTCMWEVRVIDVNENLHPPLFSCFVDKGLVKEDVPVGTSVMTVSAHDEDTGRDGE
IRYSIRDGSGVGVFKIDEEKGVIETAEKLDRETVSHYWLTVFATDQGVVPLSSFTEIYIE
IEDVNDNAPQTSEPVYYPEVMENSPKDVSVVQIEAFDPDSSSSDKLTYKITSGNPQGFFA
IHPKTGLITTTSRKLDREQQDEHILEVTVTDNGNPPKSTIARVIVKILDENDNKPQFLQK
FYKIRLPERDKPERERGAKREPIYRVIATDKDEGPNAEISYSIEDGDEHGKFFIEPKTGV
VSSKKFSGAREYDILSIKAVDNGRPQKSSTARLHIEWISKPKPSLEPISFEEPYFSFTVM
ESDPVAHMIGVISVEPIGTPLWFDIIGKIQVCAFSPEKKSFAISPASAIVEKVDIHHYSF
YTTIFTFKFQVLIKVIDTNDHRPQFSMSKYEVLIPEDTMPDTEILQISATDKDEKNKLIY
TLQSSTDPLSLRFRLDPATGSLYTAEKLDHEAVHQHVLTVMVRDQDVPVKRSFARVIVNV
SDTNDHAPWFTSSSYQGRVYESAAVGSVVLQVTALDKDKGENAEVLYSIESGNIGNSFTI
DPILGSIKTAKELDRSSQGEYDLMVKATDKGNPPMSEMTSVHIFVTISDNAIPRFTSKEY
SAEISESASIGSFIGIVRAHSQSSVVYEIKDGNIGDAFAINPNSGVIITQKALDFETLPF
YSLIVQGTNMAGLSANTTVWVHLQDENDNAPVFLQARYTGLISESAPISSVVLTDKNVPL
VIRAADADKESNALLVYQIVESSAHKYFAIDSSTGAIRTVLSLDYEEAPIFQFTVQVHDM
GTPRLFAEYAANVTIRVVDINDCPPVFSKMLYEASVLLPTYRGVKVITVNATDADSLAFS
QLMYSIPEGNIGEKFLINPKTGTITVQNTTQLRSRYELSVRASDGRFTSHASVKINVKES
KENPLKFTQNSYSARVRENSTEPRTIAVITAVGSQINEPLFYHILNPDSRFKISRTSGVL
STTGVPFDREQQEVFDVVVEVTEEHKPSVMAHVVVRVSVEDQNDNAPVFVNLPYYAAVKV
DADVGHIIRSVTAVDRDIGRNGEVHYYLKEHHEHFQIGPSGEISLKKKFEPDTLNKEYLI
TIVAKDGGDPAFSAEVVVPITVMNKAMPVFEKAFYSAEIPENIQLHSPVVHVQANSPEGL
KVFYSIMDGDPFNQFTIHFNTGVINVIAPLDFESHPAYKLSIRATDSLTGVHAEVFVDII
VEDVNDNPPVFTQQSYVTTLSEATVMGTSVVHVWATDTDSAPNRGISYHLFGNHSKSPDQ
YFHIDSSSGLISLVRTLDYEETQRHELLVRAVDSGMPPLSSDAIVTVHVTDLNDNPPLFD
QPLYEAKISEQAPHGHFVTCVKAYDADSSDTDKLEYSILSGNEQKNFAIDSKTGIITLSN
LRRQTLKPFYSVNVSVSDGVFRSSSQVEIIVIQANLHSPVFMQNEYEVELAENAPLQTLV
VEVKATDEDSGIYGQITYHIVNDFAKDRFYTNERGQIFTSEKLDRETAGEKVITIRLMAK
DTGGKVAFCTVNVILTDDNDNAPQFRATKYRVNIGSDAPKGTSVIKVLASDADEGSNADI
TYSIEADSESVQENLEINRLFGIITTKESLIGLENEVFTFFVRAVDGGSPPKESVVPVYV
KILPPETPLPKFSEPFYTYTVSEDLPIGSEIDTIRVDHSQPVSYSLTKGNTPESNGGESF
VIDKHSGKLKLEKNLDHETTKWYQFSVIAQSTHEDSEVVSFVDISIQVKDVNDNSPVLES
NPYEAFIVENLPGGSRVIQVKATDLDSGANGQVLYSLDQSQSLDVIESFAIDMETGWITT
LKELDHEKRDKYHITVVASDYGEKVQLSSTAVVEISVTDVNDNPPRFTAEIYKGTVSEDD
PPGGVIAILSTTDADTEEINRQVTYYITGGDPLGQFAVENIQNEWKVYVKKPLDREKRDS
YLLTITATDGAFSSKAIVEVKVLDANDNSPICEKSAYSDTIPEDTVPGKLIMQVSAIDAD
IRSNAEITYTLSGPGAEKFKINADTGELKTLAPLDREQQAVYNLLVQATDGGGRFCQMSV
LFTLEDVNDNAPEFSADPYAITVFENTEPKTPLTRVQATDADAGLNHKISYSLVNSADGQ
FSIDESSGIIRLEKPLDRELQAVYNLILKAVDQGLPRRLTATGTVVVSVLDINDNPPVFE
YREYGATVPEDVLVGTEVLQVYAASRDIEANAEITYAIISGNEHGKFSIDATTGAIFIID
HLDYESSHDYYLTVEATDGGTPSLSDVATVNVNVTDINDNTPVFSQDMYTAVISEDAILE
QSIVTVMADDADGPSNSHIHYSIIDGNQGNPFTIDPVRGEIKVTQLLDRETISGYTLTVQ
AADNGSPPRFNTTTVNIDVSDVNDNAPVFSKGNYSIIIQENKPVGVSVLQLMVTDKDSSH
NGPPFSFSIMSGNEEKAFEVNQDGVLITSTAIKRKVKDHYFLHVKVADNGKPQLSSLAYI
DIRVIEESIYPPAILPLEIFITTFGEEYSGGVIGKIHATDQDVYDTLTYSLDPKMDSLFS
VSSTGGKLIAHKKLDMGQYLLNVSVTDGKFTTVADIMVHIRQITQEMLNHTIAIRFANLT
PEEFVGDYWRNFQRALRNILGVRRNDIQVVSLQSSEPQSNLDVLLLVEKSGSAHASTKVL
LHKINSSVADIEEIIGVRILEVFHKLCAGLDCPLKFCDEKVTVDDSVMSTHSTARLSFVT
PRHHRAAVCLCREGRCPLVDHGCESNPCPEGTECIADPKEEKYSCVCPGGKFGQCPGEIS
LTFSGNSFVKYRLMENENKLEMKLTMRLRTYSTHAVVMYARGTDYSILEVLIHNGRLQYK
FDCGSGPGIVSVQSIQINDGQWHSVSLEVNGNYARLVLDRVHTASGTAPGTLKTLNLDNH
VFFGGHIRQQDTRPGRSHQVNNGFRGCMDSIYLNGQELPLTSKPRSYAHVEEYVDVSPGC
LLMAIEDCSSSPCQNGGICNPSPSGGYYCKCSALYMGTHCDISVNPCASNPCLYGGTCIR
DNGDFVCQCRGLYTGQRCQSDIDECAVNPCRNGALCENTHGSYRCNCSLDYRGKHCEDSL
PNKYVSTPWNIGLAEGIGIIVFIIGIFLIVVIFVVCRKTIQKKKKHQAEPEDKHLGPTTA
FLQRPYFDSKLNKSIYSDVPPQVPVRPISYTPSIPSDSRNNLDRNSFEGSTIPEHPEFST
FNPDSMHGHRKAVAVCSVAPNLPPPPPSNSPSDSDSIQKPNWDFDYDKLEPCISKKPLEE
KVSHPYSARESLSEVQSLSSFQSESCDDNGYHWDTSDWMPSVPLPDIQEFPNYEVIDEQT
PLYTDPSAIDTDYYPGGYDIESDFPPPPEDFPAPDELPPLPPEFSDQFESIQPPKDMPAT
RSLSSSTKSRQRFNFNQFLPNFYPVDMSEPQKTTNGESSSCREPFTPYPSGYSRDFEAPT
VDNMSMSVYASTASCSDVSACCEMESEVMMSDYESGEDGHFEEVTIPPLETQQHTEV
Download sequence
Identical sequences F7ERH9
13616.ENSMODP00000006174 ENSMODP00000006174 ENSMODP00000006174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]