SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006219 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006219
Domain Number 1 Region: 709-791
Classification Level Classification E-value
Superfamily DEATH domain 1.18e-19
Family DEATH domain, DD 0.00015
Further Details:      
 
Domain Number 2 Region: 51-142
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000089
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 141-191
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000017
Family TSP-1 type 1 repeat 0.00046
Further Details:      
 
Domain Number 4 Region: 195-249
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000458
Family TSP-1 type 1 repeat 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006219   Gene: ENSMODG00000005055   Transcript: ENSMODT00000006349
Sequence length 799
Comment pep:novel chromosome:BROADO5:1:382240469:382266245:1 gene:ENSMODG00000005055 transcript:ENSMODT00000006349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEVRINISRQQVEKVFGLEEYWCQCVAWSSSGTTKSQKAYVRIAYLRKNFEQEPLAKEV
SLEQGIILPCRPPEGIPPAEVEWLRNEDLVDPSLDPNVYVTREHSLVVRQARLADTANYT
CVAKNIVARRRSSSAAVTVYVNGGWSTWTEWSACSATCGRGWQKRSRSCTNPAPLNGGSF
CEGQSGQKTACATLCPVDGGWTEWSKWSACALDCTRWRSRECSEPPPRNGGEECQGADLD
TRNCTSDLCIHTASGPEDVALYVGLIAVAVCLVLLLLVLILVYCRKKEGLDSDVADSSIL
TSGFQPVSIKPTKADNSHLLTIQPDLSTTTTTYQGTLCPRQESSGPKFQLTNGHLLSPLG
SGRHTLHHSSPASEAEDFVARLSTQNYFRSLPRGASNMAYGTFNFLGGRLMIPNTGISLL
IPPDAIPRGKIYEIYLTLHKQEDVRLPLAGCQTLLSPIISCGPPGVLLTRPVILSMDHCG
EPSPENWSLRLKKQSCEGTWEDVLHLGEESPAHLYYCQLEARACHVFTEQLGRFALVGEA
LSSAAAKRLKLLLFAPTACTSLEYTIRVYCLHDTHDALKEVIQLEKQMGGQLIEEPRVLH
FKDSYHNLRLSIHDVPSSLWKSKLLVSYQEIPFYHIWNGGAQQFLHCTFTLERFSPSTTD
LACKIWIWQVEGDGQSFNVNFNINKDTRFAELLAPDNEGGVPALVGPSAFKIPFLIRQKI
ISSLDPPCGRGADWRTLAQKLHLDSHLGFFASKPSPTAMILNLWEARHFPHGNLSQLAAA
VADLGKQDTALFMVSEAEC
Download sequence
Identical sequences F7AT51
ENSMODP00000006219 XP_007474182.1.35504 ENSMODP00000006219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]