SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006233 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006233
Domain Number 1 Region: 593-854
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.06e-90
Family Eukaryotic proteases 0.000000056
Further Details:      
 
Domain Number 2 Region: 339-446
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-28
Family Spermadhesin, CUB domain 0.00091
Further Details:      
 
Domain Number 3 Region: 214-332
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-20
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 4 Region: 87-175
Classification Level Classification E-value
Superfamily SEA domain 2.22e-16
Family SEA domain 0.0069
Further Details:      
 
Domain Number 5 Region: 525-561
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000576
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 490-525
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 453-488
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 8 Region: 563-604
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000182
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006233   Gene: ENSMODG00000005064   Transcript: ENSMODT00000006363
Sequence length 855
Comment pep:novel chromosome:BROADO5:4:280446054:280519800:1 gene:ENSMODG00000005064 transcript:ENSMODT00000006363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSNRAQKGRGGKKDLGAGLKYSQQSQNINGIEEGVEFLPANNSRKVEKRGPKRWIVLLA
LVTFFILLSLMVGILVWHFNYQNARVQKIFNGYLRITNVNFIDAYENPNSTEFANLASKV
KEVLKILYSGIPALGPFYKDSGVTAFSEGSVIAYYWSEFSVPQYKVQEVDRVISKENAIM
LPLRSRAVQSFTVDSIVAFPTDARTAQTTRDNSCSFSLHAHAGEVTRFTTPGFPDSPYPL
RARCQWVLRGDADLVLSLTFQSFDIAPCDAAGSDTVMVYDSLSPVEPRAVVQLCGSYSPS
YNLTFLSSQNVMLVTLITNTVRRHPGFKAEFFQLPKMTQCGGYLSGEQGTFNTPYYPGHY
PPNIDCTWNIEVPRKQNVKIRFKFFYLVEPHATLGTCMKDFVEINGEKYCGEKPQFVVTS
NTNKITVKFHSDESYTDTGFFAEYLSYDSSDPCPGMFTCKTGRCISNNLRCDGWADCTDF
SDELQCVCNSTHHFTCTNKLCKPLYWVCDGLNDCGDNSDELQCNCPAQTFKCGNGKCIPE
SQKCDKQDNCGDGSDEAECESVWTVSCTKYTYKCRSGVCLSKGNPECDGKKDCSDGSDEN
NCDCGLRSFSKQSRIVGGQNSDEGEWPWQVSLHAEGQGHVCGASLISSTWLVSAAHCFLD
ELGIKYSDPSLWKAYLGLHDQSKRSTSGVQVRGFKQIIPHAAFNDFTFDYDIAVLELDKP
VEYTSVVRPICLPDSSHTFPAGKTIWVTGWGHTKEGGSGALVLQKGEIRVINQTTCESLL
PNQVTPRMMCVGFLNGGVDSCQGDSGGPLSSVENDGRIFLAGVVSWGEGCARRNKPGVYT
RVPVLRDWIKEKTGV
Download sequence
Identical sequences F7ASK3
ENSMODP00000006233 ENSMODP00000006233 XP_007495192.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]