SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006243 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006243
Domain Number 1 Region: 38-88
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000074
Family TNF receptor-like 0.0036
Further Details:      
 
Domain Number 2 Region: 111-169
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000253
Family TNF receptor-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006243   Gene: ENSMODG00000005072   Transcript: ENSMODT00000006373
Sequence length 670
Comment pep:novel chromosome:BROADO5:3:142009624:142130865:1 gene:ENSMODG00000005072 transcript:ENSMODT00000006373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSCRWRPLHHLQILGLCVLFSPLQLTLQIPSRCNSEKHYEHLGRCCTKCDPGKYMSAK
CTSTSESICLPCGPDEYLHTWNEEDKCLLHKVCDSGKGLTVVHPGNQTFPRQCACIPGYH
WNGDSESCQRNGKCDPGFEAENPLQPNKDPGCKPCLMGYFSNANSYNKCKSWTNCTNLGM
VEKAPGTDKSDVDCAPLPSENLGHGSPKYLQSIIFPLLLACLAVITVIIFGIYYRKEGKA
LTASMWLWVNDMCSILRRNKDSSGDNFINVHVTTSSASQAYEDVFLLTREEKTISEDSCY
PQGHIMCGEAGRCKVEETAMLSLVIETEEDNFRQIPTEDEYVDRALHGSDCLLLLSRPGS
KPASPFPEPLEVGENDSLSHCFTGTESTMDSEGSYCTKSSCRTDSIPISSESYLQKFFHC
HDSLLAKEVENSDRNHWAANPDLTNGYGGCREPLRKYTETSEKKADHITEAFENGTFPQC
TCGLDLAPESQNILANDAEGEDLSFDGTEVKFPSTKRGSSWSGGVSGDSPLASGNVTGNS
NSTFISSGQVMNFKGDIIVVYVSQNSQEGPTIPGTAGETIGSPVQEENLNRCDTFAGNDL
HFKEKCAESSLGIFSEDKAQKCLRDHTRRPGPGIQEETQHGPERENSRIPASQPVQEEGN
HKSCSQKAWQ
Download sequence
Identical sequences K7E0G0
ENSMODP00000006243 ENSMODP00000039261 XP_007486921.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]