SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006299 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006299
Domain Number 1 Region: 25-99
Classification Level Classification E-value
Superfamily Apolipoprotein A-II 5.62e-33
Family Apolipoprotein A-II 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006299   Gene: ENSMODG00000005118   Transcript: ENSMODT00000006431
Sequence length 100
Comment pep:novel chromosome:BROADO5:2:457169672:457170785:-1 gene:ENSMODG00000005118 transcript:ENSMODT00000006431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLALTVLLLTICSLEGALVRREAQDQGVQSIFSQYFQKLTDIGKDLAEKVKAPEVQTQ
VQQYFKKSQDQVIPLAQKALTDTMSFFSSLVEAGKKDASK
Download sequence
Identical sequences F6YQ34
13616.ENSMODP00000006299 ENSMODP00000006299 ENSMODP00000006299 XP_007485040.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]