SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006340 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006340
Domain Number 1 Region: 77-185
Classification Level Classification E-value
Superfamily Cadherin-like 1.4e-25
Family Cadherin 0.00049
Further Details:      
 
Domain Number 2 Region: 297-420
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-25
Family Cadherin 0.0014
Further Details:      
 
Domain Number 3 Region: 186-301
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-22
Family Cadherin 0.0013
Further Details:      
 
Domain Number 4 Region: 5-84
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000286
Family Cadherin 0.0018
Further Details:      
 
Domain Number 5 Region: 407-524
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000228
Family Cadherin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006340   Gene: ENSMODG00000005152   Transcript: ENSMODT00000006472
Sequence length 673
Comment pep:novel chromosome:BROADO5:1:172335675:172344326:-1 gene:ENSMODG00000005152 transcript:ENSMODT00000006472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLHSDVDRGEGRTKYLLTGEGAGTVFVIDEATGNIHVTKSLDREEKAQYVLLAQAVDRAS
NRPLEPPSEFIIKVQDINDNPPVFPLGPYHATVPEMSNVGTSVIQVTAQDADDPSYGNSA
KLVYTVLDGLPFFSVDPQTGVVRTAIPNMDRETQEVFLVVIQAKDMGGHMGGLSGSTTVT
VTLSDVNDNPPKFPQSLYQFSVVETAGPGALVGRLRAQDPDLGDNALMAYSILDGEGAET
FSISTDAQGRDGLLTIRKPLDFESRRSYAFRVEATNTLIDPAYLRRGPFKDVASVRVAVQ
DAPEPPVFTHSTYHLAVPENSAPGTLVGHVSAMDLDSPASPIRYSILPHSDPERCFSIEP
QDGTIRTSVPLDREARAWHNLTVLATELDSSAQASRVQVTIQTLDENDNAPQLAEPYDTF
VCDTADRVPRAALPLSPALLSQLVQVVRALDRDEVGNSSYVSLSSPLGPDANFTVRDNRD
GSASLLLPHRLALPRREPYLVPIELRDWGQPALSSTATVTVSICRCKPDGSVASCRPEAQ
LSPAGLSTGALLAILACVGTLLALVVLFVALRRQKQEALMVLEEEDVRENIITYDDEGGG
EEDTEAFDITALQNPDGAAPPASAPAARRDVLPRAQPPRQPRPPGPADVAQLLALRLREA
DEDPGVPPYDSVQ
Download sequence
Identical sequences F7EPX0
ENSMODP00000006340 ENSMODP00000006340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]