SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006348 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006348
Domain Number 1 Region: 206-410
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.6e-40
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 2 Region: 445-642
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.4e-35
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 847-1025
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-35
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 651-841
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-35
Family Laminin G-like module 0.0075
Further Details:      
 
Domain Number 5 Region: 1058-1239
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.34e-33
Family Laminin G-like module 0.00000105
Further Details:      
 
Domain Number 6 Region: 25-180
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-30
Family Laminin G-like module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006348   Gene: ENSMODG00000005150   Transcript: ENSMODT00000006480
Sequence length 1542
Comment pep:novel chromosome:BROADO5:1:241801245:243850237:-1 gene:ENSMODG00000005150 transcript:ENSMODT00000006480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFTLHSIYFTLKFSVLLGSLLGLCLGLEFMGLPNQWARYLRWDASTRSDLSFQFKTNVS
AGLLLYLDDGGVCDFLCLSLVDGRVQLHFSVDCAETAVLSDKQVNDSSWHFLMVSRDRMR
TVLVLDGEARPGEVQPQRPHMDVVSDLFVGGVPADIRPSALTLDGVQAMPAFKGFILDLK
YGNSEPRLLGSQGAQLEVEGPCGESPCENGGVCFLLDGHPTCDCSTTGYGGKLCSEGQVT
CPGTHSWEVSETARDENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTG
KSADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNAWHDVKVTRNLRQVTISVDG
ILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDIRLELS
RLARIGDTKMKIYGEVVFKCENVATLDPINFETPEAYISLPKWNTKRMGSISFDFRTTEP
NGLILFTHGKPQERKDSRSQKNTKVDFFAVELLDGNLYLLLDMGSGTIKVKATQKKANDG
EWYHVDIQRDGRSGTISVNSRRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELWT
AMLNYGYVGCIRDLFIDGRSKNIRQLAEVQNAAGVKSSCSRLSTKQCDSYPCKNNAVCKD
GWNRFICDCTGTGYWGRTCEREASILSYDGSMYMKIIMPMVMHTEAEDVSFRFMSQRAYG
LLVATTSRDSADTLRLELDGGRVKLMVNLDCIRINCNSSKGPETLYAGQKLNDNEWHTVR
VVRRGKNLKLTVDDDVAEGTMVGDHTRLEFHNIETGIMTEKRYISVIPSSFIGHLQSLMF
NGLLYIDLCKNGDIDYCELKARFGLRNIIADPVTFKTKSSYLSLATLQAYTSMHLFFQFK
TTSADGFILFNSGDSNDFIAVELVKGYIHYVFDLGNGPNVIKGNSDRPLNDNQWHNVVIT
RDNSNTHSLKVDTKVVTQVINGAKNLDLKGDLYMAGLAQGMYSNLPKLVASRDGFQGCLA
SVDLNGRLPDLINDALHRSGQIERGCEGPSTTCQEDSCANQGVCMQQWEGFTCDCSMTSY
SNNQCNDAGATYIFGKSGGLILYTWPANDRPSTRSDRLAVGFSTTVKDGILVRIDSAPGL
GDFLQLHIEQGKIGVVFNIGTVDISIKEESTPVNDGKYHVVRFTRNGGNATLQVDNWPVN
EHYPSGRQLTIFNTQAQIAIGGKDKGRLFQGQLSGLYYDGLKVLNMAAENNPNIKINGSV
RLVGEVPSLLGTTPTTSMPPEMSTTVMETTTTMATTTTRKNRSTASIQPTSDDLVSSAEC
SSDDEDFVECEPSTDKSLSTSVFEGGYKAHAPKWESKNFRPNKVSETGRTTTTTSLSPEL
IRSTASSSSGMVPKLPAGKMNNRELKPQPDIVLLPLPTAYELDSTKLKSPLITSPMFRNV
PTANPTEPGIRRVPGASEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQ
VDETRNYISNSAQSNGMLVKEKQQSSKSGHKKQKNKDKEYYV
Download sequence
Identical sequences F7EPR9
ENSMODP00000006348 ENSMODP00000006348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]