SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006366 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006366
Domain Number 1 Region: 495-675
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.08e-38
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 2 Region: 84-287
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-34
Family Laminin G-like module 0.001
Further Details:      
 
Domain Number 3 Region: 299-491
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-34
Family Laminin G-like module 0.0066
Further Details:      
 
Domain Number 4 Region: 2-65
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000119
Family Laminin G-like module 0.029
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006366
Domain Number - Region: 702-736
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000502
Family EGF-type module 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006366   Gene: ENSMODG00000021143   Transcript: ENSMODT00000006498
Sequence length 1323
Comment pep:novel chromosome:BROADO5:Un:31392492:31497198:1 gene:ENSMODG00000021143 transcript:ENSMODT00000006498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTISVDGILTTTGYTQEDYTMLGSDDFFYIGGSPNTADLPGSPVSNNFMGCLKDVVYKN
NDFKLELSRLAREGDPKMKLQGDLSFRCEDVAALDPVTFESPEAFVALPRWSAKRTGSVS
LDFRTTEPNGLLLFSQGRWAGGGQGGHGAARADYFAMELLDGYLYLLLDMGSGGIKLRAS
NRKVNDGEWCHVDFQRDGRKGSISVNSRSTPFLASGESEILDLESELYLGGLPEGGRPDL
PLPPEVWTAALRAGYVGCVRDLFIDGRSRDLRSLAEAQGAVGVAPFCSRETLKQCGTAPC
RNGGVCREGWNRFVCDCVGTGFLGRVCEREATVLSYDGSMYMKIMLPTAMHTEAEDVSLR
FMSQRAYGLMMATTSKESADTLRLELDGGRMKLTVNLVRRPAGCLCSGKGPETLFAGHKL
NDNEWHTVRVVRRGKSLQLSVDNVTVEAGQMAGAHTRLEFHNIETSIMTERRFISVVPSN
FIGHLSGLLFNGQPYMDQCKDGDITYCELNARFGLRAIVADPVTFKSRASYLALATLQAY
ASMHLFFQFKTTAPDGLLLFNSGNGNDFIVIELVKGYIHYVFDLGNGPSLMKGNSDKPVN
DNQWHNVVVSRDPGNVHTLKIDSRTVTQHSNGARNLDLKGELYIGGLSKNMFNNLPKLVA
SRDGFQGCLASVDLNGRLPDLIADALHRIGQEASLCCCPSTTCTEDSCANQGVCLQQWDG
FTCDCTMTSYGGPICNDPGVDVLTESSPGLLWDWPGRKLPMPGQDRIVVHSRPPSHPRGL
ILLREGMARGIFSSESDCHQAGGTDFWGRRWELGRQEITVSWAQPPAATSKAALLVSRGV
RPSGEAQLSLSSVPCPVPHSGLPLLISTREKNMRAGRVLRTRNMRAGRVLRTRNMRAGRV
LRTRNMRAGRVLRTRNMRAGRVLRTRNMRAGRVLRTRNMRAGRVLRTRNMRAGRVLRTWN
MRAGRVLRTRNMRAGRVLRTRNMRAGRVLRTQNMRNTDDLLVASAECPSDDEDLEECEPS
TGESDLPFVTRAQVQPLSGPRRRPAKPAKLVLGPFLAGAPGRREGHLHPMAPRRRGESRP
RLARKDQEELGGCMEPNGSPVDPEIPGSEERSGLELASLTLSRKPPSAARTPPPRPPFPI
HAAGRWADGGPRALMAPTPRPPNVRRGRLSPQLPSGGQPSFEAPSLGLPQPSPPGPPAPT
PAAPRPLMPPCPHVPSHQPQRPPPVLAPGVTAAPGLPRVIRESSSTTGMVVGIVAAAALC
ILILLYAMYKYRNRDEGSYQVDQSRNYISNSAQSNGAVVKEKAPAAPKAPGKAKKNKDKE
YYV
Download sequence
Identical sequences H9H660
ENSMODP00000006366 ENSMODP00000006366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]