SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006389 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006389
Domain Number 1 Region: 381-512
Classification Level Classification E-value
Superfamily C-type lectin-like 8.75e-31
Family C-type lectin domain 0.0009
Further Details:      
 
Domain Number 2 Region: 1252-1389
Classification Level Classification E-value
Superfamily C-type lectin-like 1.36e-30
Family C-type lectin domain 0.0021
Further Details:      
 
Domain Number 3 Region: 1126-1245
Classification Level Classification E-value
Superfamily C-type lectin-like 2.92e-28
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 4 Region: 667-808
Classification Level Classification E-value
Superfamily C-type lectin-like 4.39e-28
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 5 Region: 236-369
Classification Level Classification E-value
Superfamily C-type lectin-like 4.81e-28
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 6 Region: 961-1109
Classification Level Classification E-value
Superfamily C-type lectin-like 4.89e-28
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 7 Region: 815-947
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-27
Family C-type lectin domain 0.00073
Further Details:      
 
Domain Number 8 Region: 48-173
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.75e-25
Family Cysteine rich domain 0.0052
Further Details:      
 
Domain Number 9 Region: 519-654
Classification Level Classification E-value
Superfamily C-type lectin-like 4.55e-23
Family C-type lectin domain 0.00086
Further Details:      
 
Domain Number 10 Region: 175-231
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-21
Family Fibronectin type II module 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006389   Gene: ENSMODG00000005189   Transcript: ENSMODT00000006523
Sequence length 1468
Comment pep:novel chromosome:BROADO5:4:165412791:165576270:-1 gene:ENSMODG00000005189 transcript:ENSMODT00000006523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGQWSYQWLALPSLLLLLLLLLQGQGSSCLENPLMLTEERVSQLLGKGIFIIQNEDLKT
CIQASKFGLNLENCNQPTTSMLWKWVSKHHLYNIGTSTCLGLNLSIPEQPLGLFECDSTH
FSMWWRCNRKGIIGPYQYMLEVKNSKLVVATRQSSQKWTPYMSGSDDICEHPFQELYTVK
GNSHGMPCVFPFQYNDQWHYECTREGREDGHLWCATTSRYEKEEKWGFCPDPTSTEISCE
VFWEKDPTTHICYQFNLFSILSWSEAHSSCKMQGGDLLSIMDGTEENFIRQHLSTKAVDV
WMGLNQLDAAAGWQWSDGTPLTYLNWSPDVKFDPLLEYHCGTFNSLVTQSWRTRECESGL
PYVCKKYLNRTEHEEFDAWKYSPTHCEPGWNPYNRNCYYLQKEKSPWRAALHSCRSNNSE
LINIASLAETEFFMTLLRDENVSETWIGMSSHSIPVSFEWSNDSSVTITNWHTQEPNLSL
NSSQLCVSAQQSEGKWEVKNCEDNISYVCKKTGHVLSETKSECHEGWKRHGGFCYKIDPV
RRSFEHASSGYYCPPSLVTVTNRFEQAFITSLISSVVKMEDSYFWIALQDQNVTGEYTWK
TEGQKDEPVRYTNWNKYQPRYSGGCVVMRGKNPPGAWEVKDCRSFEAMSLCKQPVTERKK
TEYEEKWPFHPCFLGWESKPTLTSCYKVFHSEKVLMKRTWREAEAFCEDFGAHLASFSHI
EEENFVNELLHTKFNRTEERQFWIGFNKRNPLSEGSWEWSDGTPVVASFLENTYFGEDAR
NCAVYQANKTLLPLPCGSKREWICKIPRDIKPKIPSWYTHDEPWLFHQGIEYLFHSDPSD
WESFAFACAWLGGDMLNILSAIEQEFVLSRIKMLSKNDKNWWIELREERPNHGFHWRDGS
PLIYQNWDEGGERSVNNQSQRCGFISSETGLWSNADCSVYMPSICKRKNILVIEKEKEIP
KQHGLCPKGWLYFDYKCILVEIPKDQKFQKSWKSAQNFCAEEDATLASIQNEVEQAFITM
NLFGQKANVWIGLQSDNYEKWLNGEPVTYSNWAPVEIINGKSHNSTNVQEQASLCTLLSS
NPNFHFTGKWYLEDCRKSTFGFVCEKPQDTSGHNINASTMFPIPETLEYGNRTYKIISAN
MTWHAALKACTENGAELVSITDQFHQSFLTVIINRLGHSHWIGLFTSDKGLNFEWSDGTK
PYFTYWEDEESSSVGECTFVAINGRWRSTDCETLLQGAICHVPKEIKHSKYPELCRETSI
PWIKFENNCYSFSTVLNSTNFDAAFEFCKTEGANLLTIKDEAENAFLLKELFTFSSSIPT
VWLNAQYDNSNGIITWFDGSPTEQSNWGVREPESNLFKADLCFALRTTDGVWQLFPCREK
NGFICKMETDINIMKSAEAPSHSLIPLTVAVMLVAILGISTFFYCLYKQNGGFFRRFIPL
GSPPYIAANLRRLPIEESILISDLERND
Download sequence
Identical sequences F7DNC3
ENSMODP00000006389 ENSMODP00000006389 XP_003341283.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]