SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006446 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006446
Domain Number 1 Region: 190-306
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000262
Family Spermadhesin, CUB domain 0.0037
Further Details:      
 
Domain Number 2 Region: 399-436
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000288
Family LDL receptor-like module 0.00077
Further Details:      
 
Domain Number 3 Region: 143-183
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000537
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 4 Region: 37-140
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000262
Family Spermadhesin, CUB domain 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006446
Domain Number - Region: 330-354
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000131
Family LDL receptor-like module 0.0036
Further Details:      
 
Domain Number - Region: 357-398
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00864
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006446   Gene: ENSMODG00000005233   Transcript: ENSMODT00000006581
Sequence length 710
Comment pep:novel chromosome:BROADO5:1:172119945:172135385:1 gene:ENSMODG00000005233 transcript:ENSMODT00000006581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPALFLFLFLLVLPGGTDAHLDRTPFPNPACRDPPAVLSSVQGILQWPQARESRLLPIA
CIWVIVGSKEQTVTIRFQKLHLACGSERLMLQSSFQPLISLCEAPSNPLRFSGGNVTITY
SYAGNGRPLGQGFLLSYMLDRFICLREEFRCLNRRCVPRIQRCDGIDNCGDQSDETDCSP
SLFHSLTAVPTPACNRTLEDFYGVFSSPSYSLSALYPSPHSCLWLLDPHDGRRLIVRFTT
LELGKWDSVHVYDGPGPPDPSRLLRSLNYFSNGKAIMVETLSGKATVTYHMGPWSKGGFN
ATYHVKGYCLPWDRPCGAGSGEGPGEGPGEGCYSEAQRCDGIWDCADGTDEKDCPGCLPG
RYPCGAPGTPGATACYPSADRCNYQTFCVNGADEQQCRHCQPGNFRCRDDRCVYETWVCD
GQPDCSDGSDEWDCAYALPRKVITAAVIGSLICGLLLVIALGCTCKLYAIRTQEYSIFAP
LSRVEAEIVQQQAPPSYGQLIAQGAIPPVDDFPTENPNDNSVLGNLRSLLQILRQDVSSG
GSSSARRRQRGRSARRLVRRLRRWGLLPRANPPSRAPDSSLQTASTPSTTDTPEGSQGTP
LEGAMGGRDPEEAPPLPVKVPLSSTNSPCIPPEDPPPPITPPPPPSSLLSGVVQALRGRL
MPSLRSPTPPQAIPDPRTVPPSQEEEDDVLLLPLAEPGPWVGEEDEPLLT
Download sequence
Identical sequences F6ZCI9
ENSMODP00000006446 XP_001379916.1.35504 ENSMODP00000006446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]