SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006535 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006535
Domain Number 1 Region: 244-565
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.22e-62
Family Pancreatic carboxypeptidases 0.0000103
Further Details:      
 
Domain Number 2 Region: 68-226
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.12e-47
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00035
Further Details:      
 
Domain Number 3 Region: 567-664
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.22e-17
Family Carboxypeptidase regulatory domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006535   Gene: ENSMODG00000005298   Transcript: ENSMODT00000006670
Sequence length 677
Comment pep:novel chromosome:BROADO5:5:238091363:238101032:-1 gene:ENSMODG00000005298 transcript:ENSMODT00000006670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALLGFPPTPPFLLLSAKPVLQVKVRVVKKKKVVVKKRKKLGPTHPSPGNQEITPEPEDGL
MPCQTEACCPPLGLESLRVSDEQFQASSSQSYGLGAHRGRLNIQWMGDLFDGAWCPEPED
DWPWLQVDAGRLARFTGVITQGRNSIWRYDWVTSYKIQFSNDTLTWWGTKNRSSGLDEVF
PGNSDPDTPVLVLLTQPQVARYIRLLPQTWLQGGAACLRLEVLACLLPDPNGFFPREPQL
GSSDPLDFRHHDYKAMRKLMKKVNDQCPNITRVYSIGKSHQGLKLYVMEMSDQPGEHELG
EPEVRYVAGMHGNEALGRELLLLLMQYLCLEFLRGNPRVTRLLTETRIHLLPSMNPDGYE
IAYRRGSELVGWAEGRWTHQYIDLNHNFADLNTPLWEAEDDGLVPHSFPNHHLPLPAYYT
MPNATVAPETRAVIDWMQRIPFVLSANLHGGELVVSYPYDMTRTPWEARELTPTPDEPVF
RWLSTVFAGTSRAMQEPGRRPCHSEDFSHHGHIINGAEWHSVAGSASLQTHCVILSQATF
PHESELPQEWENNKDALITYLEQVRVGISGLVLDKDTEQGIPDAVIAVDGINHDVTTAPG
GDYWRMLTPGDYMVTASAEGYHSATKPCRVSFEEGPTLCHFRLSKTPKQRLRELLASGVK
VPPDLRRRLDRLRGRGV
Download sequence
Identical sequences F7DML2
ENSMODP00000006535 ENSMODP00000006535 13616.ENSMODP00000006535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]