SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006550 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000006550
Domain Number - Region: 40-81
Classification Level Classification E-value
Superfamily Prefoldin 0.0942
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006550   Gene: ENSMODG00000005310   Transcript: ENSMODT00000006686
Sequence length 442
Comment pep:novel chromosome:BROADO5:4:166954675:167046287:1 gene:ENSMODG00000005310 transcript:ENSMODT00000006686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIFVIDTILFSDATRQKGMDKNMGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRI
REQQEQLSLQQSIIDKLKSQLLLVNSSRDNLHGYVPMLEESEKRKTDKPLNVTFDQPYDK
VKSGIPREKHSKNIHFRNHYFDQLPTLMYFSLMGNKHLVKRPETSPRQENFPGNPDFSLF
NKREEIEKTFYEMKEEFHRICMLARAQREHLNRLNIQEPIPEIQFSMPIQCTDEQQTEEP
LKPQVKDVINRGSSCITSITPRGLGQEEEDNSLESLSKFNVKFPPTDNDSTFLHSTPEKP
QVMVPARTEPVGQDKFDRELRDSSVAFVKPEGTLFEMNRIDLITSAMQNIKTSDKTKPSH
PTDTCTKKTLEKAACLPVGDHDIIYVNTFLQAQDTSEVLFASPDSPGRAVRGPQQFRAEE
QIGTLGAKWRSKLVSTSPSTII
Download sequence
Identical sequences F7DLM0
ENSMODP00000006550 ENSMODP00000006550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]