SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006553 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006553
Domain Number 1 Region: 37-153
Classification Level Classification E-value
Superfamily TPR-like 0.00000337
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000006553
Domain Number - Region: 369-444
Classification Level Classification E-value
Superfamily DEATH domain 0.0179
Family Caspase recruitment domain, CARD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006553   Gene: ENSMODG00000020986   Transcript: ENSMODT00000006689
Sequence length 1521
Comment pep:novel chromosome:BROADO5:4:4907402:4999266:-1 gene:ENSMODG00000020986 transcript:ENSMODT00000006689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKPSLQLNLQIDLQSLLDKQFSKSSRAVQQDFAILIKMLQSLIEEGCTALMDQHCRSAA
KAFSRLLSDLDPNKLKQLNLALINYVLVIYGYAISLLGIGLPEELSEAEYQFKRIIDQYP
NEGVDCLAYFGIGKVYLKKNRFSDALGHFEKSKTMIKLIPGVLTWPTTNVIIEESQAEKL
QLILENHIEECKFPPNPDAVCCYQKCNGYSKIQIYLSDPDFKGFIRINCCQFCRIEFHIS
CWKKLKTTIFNDKNDKEFLQETCLTPDCRGIISKIVIFGATGHIKCEFEHRVTKEKDPPR
PVMKQKCSSLEKLKIKEEKKVKRKLQRKEAKKIAKERLEEKTAENNSSTQGDHKGFVQSC
QFPDDRVLQCIKQNAEQIKSGIQDTSKLLRDLLCWKVINTEDYADSYFNSNFLRETVEHL
LEHLIRKNNRVNTRIFLHVLSEINEVKPKLRDWINKLNTLGLDATRMFFSRYGDCIKELD
FKLIAVLWDEKYGRKLDHVITIREERDVVGYFNNPGSLKEARSIIWLLEENRDKFPALHN
ALDEFFDIMDGPCTILRKQENEDISTNGIKVKNKTRKKKHKESKPIFILSGVGGVTQNDD
KTGTDESSVLPSNSYDPFVVPDYLRDEVEEFEALYEKSSSNNSHYQKLNSNLDPKCEPLY
DYFSQILEEHGPLEIDDKLLVGEYELFPEETRKIVEEAGGLKSFLLDSLRFVMIDSYIGL
MKDAVQLKKSKSPGAGAEESTSLDKKGSTFPPPFQKNASQFKPQLNPAAKEFKPVSCNSH
TPASKSKKGNRAAKHAAAAHTAHNALNSGFSNQGFDTSNTPVSHANGSPQSSQCVNVCTP
APDTASDYQTKRKLPPASAAAPVTDTDRRDSHIHANYEACHVTTEKPMGNALEKGCSSGK
PTYEKQLHQNTQKTTAKSDTLKNNPAKDAHSRNNDHCNAGTSKVEAEMKNTPAAKNTPCT
RMVAIQVKKDLMHQEVNTVPFGPFETQQGDILRMEKEHQVLQEQLKEAKEKYEQLKCRST
EETRELEEKLKRTMEENKITKTELNWFHQDLEIEMKKWQQEKKENHEKLKTLRNKVKKLT
DSSETYSRNNEEKDQQYASHLDQFLKISNKFANEKLKMEELIKKGKENYHEAIKRAVAAE
VTILENWKNTDVNKLQITLSKAEMYIKNLKLMNSGSVSYLNLESEISHWESFISKIKQEM
EKAEFEFDDRIQKVKAGSQLDKLSKVKVPEFPLPTNSLLIQGKLAHTNDPSTKTYSTQVH
PKSLPEFSCLDDQSPVNGPTNLFAGNQTLALQNASLLSASDGSLEIPSALLQAAYTDPGQ
AVDSETDAQINQSPRDVAQTHASTLNQPQKTFNSVIEHLAAIFPNYSSAELLSFIQEVQK
QDGSTQAGLESDEMVRNVTELILDEQNKKSAVEGKDMVSVPSGATTAAESSGLXTRTFCL
RNTGHPQHQLFFVPSQSLRDFGLCSGCYGHFNPVTPWRFPVLISQQHLKSRLLLSQTAGL
SMPTTGQGDTLRHKGADHVAV
Download sequence
Identical sequences F7DLK1
ENSMODP00000006553 ENSMODP00000006553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]