SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006612 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006612
Domain Number 1 Region: 27-129
Classification Level Classification E-value
Superfamily Prefoldin 3.14e-27
Family Prefoldin 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006612   Gene: ENSMODG00000005360   Transcript: ENSMODT00000006749
Sequence length 157
Comment pep:novel chromosome:BROADO5:2:456987200:456998161:-1 gene:ENSMODG00000005360 transcript:ENSMODT00000006749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESSNRCNKSSGSGAGNAGKGAVSAEQVVAGFNRLRQEQRGLASKAAELEMELNEHSLV
IDTLREVDPTRKCYRMVGGVLVERTVKEVLPALEGNKEQIQKIIETLTQQLQAKGRELNE
FREKHNIRLMGEDEKPAAKDNGEGSGAKASSAGVLVS
Download sequence
Identical sequences F6YLE9
ENSMODP00000006612 13616.ENSMODP00000006612 XP_001371929.1.35504 ENSMODP00000006612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]