SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006615 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006615
Domain Number 1 Region: 32-496
Classification Level Classification E-value
Superfamily Cytochrome P450 1.83e-131
Family Cytochrome P450 0.00000000000338
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006615   Gene: ENSMODG00000005361   Transcript: ENSMODT00000006752
Sequence length 499
Comment pep:novel chromosome:BROADO5:1:76489213:76508342:-1 gene:ENSMODG00000005361 transcript:ENSMODT00000006752 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPSVVTALGLIFCVSCLLLISAWRKGFGKGKLPPGPTPLPIIGNLLQLDTKNINKSFCE
LAKTYGSVFTLYLGSERAVVLHGQKAVKEALIGNGDAFAGRGSFPISETINKGLGLLFSN
GERWKQIRRFSLMTLRNFGMGKRSIEERVQEEAKRLVEALKNTNGLPCDPTFIFGCAPCN
VICSVVFQKHFEYQDKKFLTLMEYLNENLQILSSPWIQVYNLFPSLIHHLPGIHHKVIKN
FRALNDFVLERVKEHQETVDPNDPRDFIDCFLMKMEQEKQNPKSEFIIENLVSTTIDLFG
AGTETTSTTLRYGFLLLLKHPQIVDKIREEMDQVIGQNRSPCMKDRSSMPYTDAVIHEIQ
RYIDLVPTSLPHAVTQDVKFRQYLIPKGTTIIPLLTSVLYDNEEFPNPEQFDPGHFLDES
GNFKKSDYFVPFSIGKINRKRACVGESLAQMELFLFFTTILQNFTLKPLVDPKDIDVTPI
SNGFNHVPPCYELCFLPSQ
Download sequence
Identical sequences F6YLC4
ENSMODP00000006615 ENSMODP00000006615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]