SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006626 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006626
Domain Number 1 Region: 33-492
Classification Level Classification E-value
Superfamily Cytochrome P450 1.13e-133
Family Cytochrome P450 0.00000000000767
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006626   Gene: ENSMODG00000005374   Transcript: ENSMODT00000006764
Sequence length 496
Comment pep:novel chromosome:BROADO5:1:76528583:76553024:-1 gene:ENSMODG00000005374 transcript:ENSMODT00000006764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSVVIFLILVLCISCLFLISSRKKSHGKGQLPPGPFPLPIVGNLLQLDTKHIDKSLGS
LTKVYGPVYTLHFGSERVVVLHGYEAVKEALIDHGEEFAARGSLPIIDAVSKGFGLVFSK
GERWKELRRFSLMTLRNLGMGKRSIEERVQEEAKYLVEEFKKSNGQPCDPKFILECVPCN
VICSVIFQKRFEYSDRKLQTLMELLDENIKILTSPWIQVYNFIPSLVHYLPGPHRTFLNN
CKIMHNFIEEKVKEHQETLDSNNPQDFIDYFLIQMGQKKQNQQSEFTMENLILTVSDLFI
AGSETTSTTLRYGLLLLLKYPEITDKIHEEIDRVIGRDRSPCMKDRNSMPYTDAVIHEIQ
RHLDLIPFNLPHAVKQDTRFREYVIPKDTTIFTSLSSVLYDEKEFPNADQFDPGHFLDES
GNFKKSDYFMPFSIGKRACVGEGLARMELFLFFTNILQNFTLKPLIDPKDIDTTPISNGF
GCVPPSYKLHFLPVVK
Download sequence
Identical sequences F6YL42
XP_001374794.1.35504 XP_007478832.1.35504 ENSMODP00000006626 ENSMODP00000006626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]