SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006681 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006681
Domain Number 1 Region: 47-157
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-31
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 259-370
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-26
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 3 Region: 450-488
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 164-200
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 5 Region: 411-449
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000128
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 6 Region: 212-254
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 7 Region: 374-411
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000733
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006681   Gene: ENSMODG00000005408   Transcript: ENSMODT00000006819
Sequence length 858
Comment pep:novel chromosome:BROADO5:3:371383767:371515947:-1 gene:ENSMODG00000005408 transcript:ENSMODT00000006819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRGSTKEPPGWRSARLLLFLVSVGGNGALAEHSENVHISGVSTACGETPEQIRGPSGI
ITSPGWPFEYPARINCSWYIRANPGEIITISFQDFDIQGSRRCNLDWLTIETFKNVESYR
ACGSTIPPPYISSQDHVWIKFHSDDSISRKGFRLAYFSGKSDEPNCACDQFRCGNGKCIP
ETWKCNNMDECGDNSDEEICAKEADPPTASSFQPCAYNQFQCLSRFTKVYTCLPESLKCD
GNIDCLDLGDEIDCDVQTCGQWLKYFYGTFNSPNYPDFYPPGSNCTWLIDTGDHRKVILR
FTDFKLDGTGYGDYVKIYDGLEENPHKLLRVLTAFDSHAPLTVVSSSGQIRVHFCADKVN
AARGFNATYQVDGFCLPWEIPCGGNWGCYTEQQRCDGYWHCPNGRDEINCTMCQKEEFPC
SRNGVCYPRSDRCNYQNHCPNGSDEKNCFFCQPGNFHCKNNRCVFESWVCDSQDDCGDGS
DEENCPVIVPTRVITAAVIGSLICGLLLVIALGCTCKLYSLRMFERRSFETQLSRVEAEL
LRREAPPSYGQLIAQGLIPPVEDFPVCSPNQASVLENLRLAVRSQLGFTSIRLPIAGRSS
NIWNRIFNFARSRHSGSLALVSADGDDVPTQNSSREPERNTAHRNLFSVESDDTDTENER
RDTAGAVGGVAAPLPQKVAPTTAIEATVGACGSSSSQNTRSGNTDNGRDVSSVEPPSVSP
ARHQLTSALSRVTQGLRWVRFTLGRSSSVNQNQSPLRQLDNGVSGREEDDDVEMLIPVSD
VASDFDVNDCSRPLLDLASDQGQGLRQPYSAAHHGVRPCNRDGPCERCGIVHTAQIPDSC
LEPTLKSETSDDEALLLC
Download sequence
Identical sequences F7FVQ5
ENSMODP00000006681 XP_007488267.1.35504 ENSMODP00000006681 13616.ENSMODP00000006681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]