SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000006720 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000006720
Domain Number 1 Region: 32-493
Classification Level Classification E-value
Superfamily Cytochrome P450 9.82e-132
Family Cytochrome P450 0.0000000000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000006720   Gene: ENSMODG00000005439   Transcript: ENSMODT00000006858
Sequence length 497
Comment pep:novel chromosome:BROADO5:1:76559716:76607259:-1 gene:ENSMODG00000005439 transcript:ENSMODT00000006858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSSMVTAFGLVCCTLCLLLISALRKRCGKGKLPPGPGPLPIIGNILQLDTKNIPKSLCM
LAKVYGPVFTLYLGSKSVVVLHGYKAMKEALIDHGEEFAGRGSFPIIDAINKGLGLAFSN
GERWKQIRRFSLMTLKNLGMGKRSIEERVQEEAKCLVEALKKTNGMPCDPTFILGCAPCN
VICSIIFQKRFEYHDQKFLHLMKLLDEKVKILSSPWIQIYNLLPLLAQYLPGSHHKLFKI
SQMMHNFFLEKVKEHQDALDPNNPQDLIDSFLIKMEQEKEKPQSEFTMENLVCTVSDIFG
AGTQTTSTTLRYGLLLLLKHPEITGKIHEEIDRVIGHNRSPCLKDRNSMPYTDAVIHEMQ
RYIDLVPANLTHSVIQDVKFRQYIIPKGTTIIPLLTSVLYDNEEFPNPDQFDPGHFLDES
GNFKKSDYFMPFSAGKRICIGEGLARMELFLFFTTILQNFTLKSLIDPKDIDTTPIASGF
GNIPPSFKLCFLPSQNV
Download sequence
Identical sequences F7D0J8
ENSMODP00000006720 XP_001374818.1.35504 XP_007478834.1.35504 ENSMODP00000006720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]